ACTR1A Antibody
Mouse Polyclonal anti-ACTR1A - ARP1 actin-related protein 1 homolog A, centractin alpha (yeast), MaxPab Antibody
Price: $295.00
  • Catalog Number: H00010121-B01
  • Unit Size: 0.05 ml
Product Images
Western Blot analysis of ACTR1A expression in transfected 293T cell line by ACTR1A MaxPab polyclonal antibody (B01).<br><br>Lane 1: ACTR1A transfected lysate(42.60 KDa).<br>Lane 2: Non-transfected lysate.<br> ACTR1A MaxPab polyclonal antibody (B01), Lot # 08010 WULz. Western Blot analysis of ACTR1A expression in human liver. 
Gene ID 10121 Reference Sequence  
Species Summary Hu(+) Application Summary ELISA, WB 
Purity  Host Mouse 
Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background

This gene encodes a 42.6 kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 8-13 copies per dynactin molecule, and is the most abundant molecule in the dynactin complex. It is an actin-related protein, and is approximately 60% identical at the amino acid level to conventional actin.
Immunogen

ACTR1A (-, 1 a.a. ~ 376 a.a) full-length human protein.
Epitope

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSR
Species Reactivity

Human.
Uses

Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA.
Dilutions

ELISA, Western Blot 1:500
Packaging

0.05 ml of mouse antisera with 50% glycerol.
Buffer

This antibody is in antisera and the concentration is unavailable.
Preservative

No Preservative
Alternate Names

anti-ARP1 antibody
Notes

This antibody is supplied by Abnova. The immunizing protein may also available for this product. Unit cost for the protein is $ 250 (2 ug), $ 305 (10 ug), and $ 445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene Symbol

ACTR1A