beta Glucuronidase Antibody (H00002990-B01P)

beta Glucuronidase Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
beta Glucuronidase Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:GUSB
Purity:Protein A purified
Host:Mouse
Specificity:Reacts with glucuronidase, beta.
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional beta Glucuronidase Products
beta Glucuronidase Antibody Details:
Immunogen:GUSB (NP_000172.1, 1 a.a. ~ 651 a.a) full-length human protein.
Epitope:MARGSAVAWAALGPLLWGCALGLQGGMLYP QESPSRECKELDGLWSFRADFSDNRRRGFE EQWYRRPLWESGPTVDMPVPSSFNDISQDW RLRHFVGWVWYEREVILPERWTQDLRTRVV LRIGSAHSYAIVWVNGVDTLEHEGGYLPFE ADISNLVQVGPLPSRLRITIAINNTLTPTT LPPGTIQYLTDTSKYPKGYFVQNTYFDFFN YAGLQRSVLLYTTPTTYIDDITVTTSVEQD SGLVNYQISVKGSNL
Species Reactivity:

Human

Applications:
Uses:This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA.
Dilutions:ELISA, Western Blot
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Store at -20 °C. Avoid freeze-thaw cycles.
Buffer:1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: GUSB
Entrez2990 (Human)
Swiss ProtNP_000172.1 (Human)
 
Background:

The GUSB gene encodes beta-glucuronidase (EC 3.2.1.31), a lysosomal hydrolase involved in the stepwise degradation of glucuronic acid-containing glycosaminoglycans (Shipley et al., 1993 [PubMed 7680524]). It is a tetrameric glycoprotein composed of identical subunits (Oshima et al., 1987 [PubMed 3468507]). The GUSB gene is mutated in mucopolysaccharidosis type VII (MPS7; MIM 253220).[supplied by OMIM]

Jump to: Images, Ask a Question

Working with beta Glucuronidase

beta Glucuronidase Antibody Images (2)
Western Blot analysis of GUSB expression in transfected 293T cell line by GUSB MaxPab polyclonal antibody.

Lane 1: GUSB transfected lysate(71.61 KDa).
Lane 2: Non-transfected lysate.
GUSB MaxPab polyclonal antibody. Western Blot analysis of GUSB expression in human liver.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about beta Glucuronidase? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
beta Glucuronidase LysateH00002990-T01HuWB(2)

beta Glucuronidase LysateNBL1-11412WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
beta Glucuronidase Recombinant ProteinH00002990-P01HuELISA, WB(1)

Primary Antibodies (7)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
beta Glucuronidase AntibodyNBP1-87511HuIF, IHC-P, WB(3)

beta Glucuronidase Antibody (105)NBP1-42247Hu, RtELISA, IHC-Fr, WB

beta Glucuronidase AntibodyNBP1-69355HuIHC, WB(1)

beta Glucuronidase AntibodyH00002990-B01HuELISA, WB(2)

beta Glucuronidase AntibodyH00002990-D01PHuFunc, WB

... and 2 more. See All »
Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

beta Glucuronidase in Context


Novus Explorer for beta Glucuronidase gene

Try our bioinformatic tool that shows the relationships between GUSB and other genes, diseases, pathways and post-translational modifications.