beta Glucuronidase Antibody (H00002990-B01)
beta Glucuronidase Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-MPS7 antibody, |
|
|
beta Glucuronidase Antibody Summary: | | Gene: | GUSB |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | GUSB - glucuronidase, beta, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional beta Glucuronidase Products beta Glucuronidase Antibody Details: | Immunogen: | GUSB (1 a.a. ~ 651 a.a) full-length human protein. |
|---|
| Epitope: | MARGSAVAWAALGPLLWGCALGLQGGMLYP QESPSRECKELDGLWSFRADFSDNRRRGFE EQWYRRPLWESGPTVDMPVPSSFNDISQDW RLRHFVGWVWYEREVILPERWTQDLRTRVV LRIGSAHSYAIVWVNGVDTLEHEGGYLPFE ADISNLVQVGPLPSRLRITIAINNTLTPTT LPPGTIQYLTDTSKYPKGYFVQNTYFDFFN YAGLQRSVLLYTTPTTYIDDITVTTSVEQD SGLVNYQISVKGSNL |
|---|
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The GUSB gene encodes beta-glucuronidase (EC 3.2.1.31), a lysosomal hydrolase involved in the stepwise degradation of glucuronic acid-containing glycosaminoglycans (Shipley et al., 1993 [PubMed 7680524]). It is a tetrameric glycoprotein composed of identical subunits (Oshima et al., 1987 [PubMed 3468507]). The GUSB gene is mutated in mucopolysaccharidosis type VII (MPS7; MIM 253220).[supplied by OMIM]
|
Images (2) Reviews (0) Related Products (10)
|
Jump to: Images, Ask a Question
|
Working with beta Glucuronidase
beta Glucuronidase Antibody Images (2) Western Blot analysis of GUSB expression in transfected 293T cell line by GUSB MaxPab polyclonal antibody (B01).
Lane 1: GUSB transfected lysate(74.70 KDa).
Lane 2: Non-transfected lysate.
|  GUSB MaxPab polyclonal antibody (B01), Lot # 08057 WULz. Western Blot analysis of GUSB expression in human liver. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about beta Glucuronidase? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (7)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| beta Glucuronidase in Context
|
Novus Explorer for beta Glucuronidase gene
|
|
