| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | XBP1 (NP_005071.2, 1 a.a. - 261 a.a.) full-length human protein. MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN |
| Specificity | XBP1 - X-box binding protein 1, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | XBP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for XBP1 Antibody (H00007494-B01P)Find related products by research area.
|
|
IRE1 alpha Regulates Dendritic Cell Function in Response to Viral Infection By Natalia Gurule, PhD What is IRE1 alpha?Inositol- requiring enzyme type 1 alpha (IRE1a) is a serine/threonine kinase that is one of the three transducers within the unfolded protein response (UPR) signalin... Read full blog post. |
|
Analysis of Total & pSer724 IRE1 alpha, the Sensor of ER Stress Inositol-requiring protein 1/IRE1 alpha (also called Endoplasmic Reticulum to Nucleus Signaling 1/ERN1; predicted mol wt 110 kDa) is a serine-threonine protein kinase/endoribonuclease which plays a highly critical role in unfolded protein response/U... Read full blog post. |
|
IRE1 - an important sensor in the unfolded protein response pathway During cellular stress the protein folding capacity of the ER is diminished. In order to maintain homeostasis and ensure proper protein folding cells activate the unfolded protein response (UPR), a signaling network consisting of sensors and effect... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | XBP1 |
| Entrez |
|
| Uniprot |
|