Titin Antibody (H00007273-M07)

Titin Antibody (2F12)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
Titin Antibody (2F12) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:TTN
Purity:IgG purified
Host:Mouse
Specificity:TTN - titin
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Titin Products
Titin Antibody (2F12) Details:
Clone:2F12
Isotype:IgG Mix Kappa
Immunogen:TTN (AAH58824, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope:MTTQAPTFTQPLQSVVVLEGSTATFEAHIS GFPVPEVSWFRDGQVISTSTLPGVQISFSD GRAKLTIPAVTKANSGRYSLKATNGSGQAT STAELLVKAETAPPNFVQRL*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: TTN
Entrez7273 (Human)
OMIM188840, 600334,
Swiss ProtAAH58824 (Human)
 
Background:

This gene encodes a large abundant protein of striated muscle. The product of this gene is divided into two regions, a N-terminal I-band and a C-terminal A-band. The I-band, which is the elastic part of the molecule, contains two regions of tandem immunoglobulin domains on either side of a PEVK region that is rich in proline, glutamate, valine and lysine. The A-band, which is thought to act as a protein-ruler, contains a mixture of immunoglobulin and fibronectin repeats, and possesses kinase activity. A N-terminal Z-disc region and a C-terminal M-line region bind to the Z-line and M-line of the sarcomere respectively so that a single titin molecule spans half the length of a sarcomere. Titin also contains binding sites for muscle associated proteins so it serves as an adhesion template for the assembly of contractile machinery in muscle cells. It has also been identified as a structural protein for chromosomes. Considerable variability exists in the I-band, the M-line and the Z-disc regions of titin. Variability in the I-band region contributes to the differences in elasticity of different titin isoforms and, therefore, to the differences in elasticity of different muscle types. Of the many titin variants identified, five for which complete transcript information is available are described. Mutations in this gene are associated with familial hypertrophic cardiomyopathy 9 and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma.

Jump to: Images, Ask a Question

Working with Titin

Titin Antibody (2F12) Images (1)
Detection limit for recombinant GST tagged TTN is approximately 0.03ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Titin? Ask us by using live chat or by submitting your questions below:

 
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Titin Partial Recombinant ProteinH00007273-Q01HuELISA, WB(1)

Titin Recombinant ProteinH00007273-P01HuELISA, WB(1)

Titin Partial Recombinant ProteinH00007273-Q02HuELISA, WB(1)

Primary Antibodies (9)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Titin Antibody (T11)NB600-1206Bv(-), Ch, Fi, Hu, Mu(-), Po, Rb, RtIF, IHC-Fr, WB(1)

Titin Antibody (6H5)H00007273-M09HuELISA, IHC-P, WB(3)

Titin Antibody (2B3)H00007273-M02HuELISA, IHC-P, WB(3)

Titin Antibody (7D3)H00007273-M06HuELISA, IHC-P, WB(2)

Titin AntibodyNBP1-88071HuIHC-P(1)

... and 4 more. See All »
RNAi (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Titin RNAiH00007273-R12Hu(1)(4)

Titin RNAiH00007273-R13Hu(1)(4)

Titin RNAiH00007273-R15Hu(1)(4)

Titin RNAiH00007273-R11Hu(1)(4)

Titin RNAiH00007273-R14Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Titin in Context


Research Areas related to Titin (2):
Novus Explorer for Titin gene

Try our bioinformatic tool that shows the relationships between TTN and other genes, diseases, pathways and post-translational modifications.