Home » Dtk/TYRO3 » Dtk/TYRO3 Proteins » Recombinant Human Dtk/TYRO3 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human Dtk/TYRO3 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Dtk/TYRO3 Peptides and Proteins

Order Details


    • Catalog Number
      H00007301-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Dtk/TYRO3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 50-150 of Human TYRO3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
TYRO3

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Dtk/TYRO3 Protein

  • Brt
  • BYK
  • Dtk
  • EC 2.7.10
  • EC 2.7.10.1
  • FLJ16467
  • Rse
  • Sky
  • Tif
  • TYRO3 protein tyrosine kinase
  • Tyro3
  • Tyrosine-protein kinase byk
  • Tyrosine-protein kinase DTK
  • tyrosine-protein kinase receptor TYRO3
  • Tyrosine-protein kinase RSE
  • Tyrosine-protein kinase SKY

Background

TYRO3 - TYRO3 protein tyrosine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Axl Antibody
[Unconjugated]
AF854
Immunohistochemistry Axl Antibody [Unconjugated]
Immunohistochemistry Axl Antibody [Unconjugated]
Immunohistochemistry Axl Antibody [Unconjugated]
(2 Reviews)
(63 Publications)
Species: Mu
Applications: IHC, WB
Gas6 [Unconjugated]
885-GSB
Bioactivity Gas6 [Unconjugated]
(1 Review)
(41 Publications)
Species: Hu
Applications: BA
Mer Antibody
[Unconjugated]
AF591
Flow Cytometry Mer Antibody [Unconjugated]
Immunohistochemistry Mer Antibody [Unconjugated]
Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]
(2 Reviews)
(71 Publications)
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(48 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(57 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
RNF111 Antibody
(1C4) - Azide and BSA ...
H00054778-M05
ELISA RNF111 Antibody (1C4) - Azide and BSA Free
Western Blot RNF111 Antibody (1C4) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence RNF111 Antibody (1C4) - Azide and BSA Free
(14 Publications)
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(850 Publications)
Species: Hu
Applications: BA
S100A10 Antibody
[Unconjugated]
AF2377
Western Blot S100A10 Antibody [Unconjugated]
Immunohistochemistry S100A10 Antibody [Unconjugated]
Simple Western S100A10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(52 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(31 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
P11 Antibody - BSA
Free
NBP2-55877
Immunohistochemistry-Paraffin P11 Antibody - BSA Free
Immunohistochemistry-Paraffin P11 Antibody - BSA Free
Immunohistochemistry-Paraffin P11 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC,  IHC-P
Exosome component
6 Antibody - BSA Free
NBP1-57508
Western Blot Exosome component 6 Antibody - BSA Free
Immunohistochemistry-Paraffin Exosome component 6 Antibody - BSA Free
Immunohistochemistry-Paraffin Exosome component 6 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(716 Publications)
Species: Mu
Applications: ELISA
Recombinant Human
Dtk/TYRO3 Protein
H00007301-Q01
Recombinant Human Dtk/TYRO3 Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Dtk/TYRO3 Partial Recombinant Protein (H00007301-Q01) (0)

There are no publications for Dtk/TYRO3 Partial Recombinant Protein (H00007301-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dtk/TYRO3 Partial Recombinant Protein (H00007301-Q01) (0)

There are no reviews for Dtk/TYRO3 Partial Recombinant Protein (H00007301-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Dtk/TYRO3 Partial Recombinant Protein (H00007301-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dtk/TYRO3 Products

Research Areas for Dtk/TYRO3 Partial Recombinant Protein (H00007301-Q01)

Find related products by research area.

Blogs on Dtk/TYRO3

There are no specific blogs for Dtk/TYRO3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Dtk/TYRO3 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TYRO3