Home » Tripeptidyl-Peptidase I/TPP1 » Tripeptidyl-Peptidase I/TPP1 Proteins » Recombinant Human Tripeptidyl-Peptidase I/TPP1 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human Tripeptidyl-Peptidase I/TPP1 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related Tripeptidyl-Peptidase I/TPP1 Peptides and Proteins

Order Details


    • Catalog Number
      H00001200-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Tripeptidyl-Peptidase I/TPP1 Protein Summary

Description
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-110 of Human TPP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF
Protein/Peptide Type
Partial Recombinant Protein
Gene
TPP1

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Western Blot , ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Tripeptidyl-Peptidase I/TPP1 Protein

  • Cell growth-inhibiting gene 1 protein
  • ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease)
  • CLN2
  • CLN2EC 3.4.14.9
  • growth-inhibiting protein 1
  • LINCL
  • LPIC
  • lysosomal pepstatin insensitive protease
  • Lysosomal pepstatin-insensitive protease
  • MGC21297
  • TPP1
  • TPP-1
  • TPP-I
  • Tripeptidyl aminopeptidase
  • tripeptidyl peptidase I
  • tripeptidyl-peptidase 1
  • TripeptidylPeptidase I
  • Tripeptidyl-Peptidase I

Background

TPP1 - tripeptidyl peptidase I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPT1 Antibody
(OTI1F10)
NBP2-45388
Western Blot PPT1 Antibody (OTI1F10)
Immunohistochemistry-Paraffin PPT1 Antibody (OTI1F10)
Immunohistochemistry-Paraffin PPT1 Antibody (OTI1F10)
(2 Publications)
Species: Hu
Applications: IHC,  IHC-P, WB
CLN3 Antibody -
BSA Free
NBP3-47582
Immunohistochemistry CLN3 Antibody - BSA Free
Western Blot CLN3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
CSP Antibody - BSA
Free
NBP1-87974
Immunohistochemistry-Paraffin CSP Antibody - BSA Free
Immunohistochemistry-Paraffin CSP Antibody - BSA Free
Immunohistochemistry-Paraffin CSP Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
Nucleolin Antibody
- BSA Free
NB600-241
Immunocytochemistry/ Immunofluorescence Nucleolin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Nucleolin Antibody - BSA Free
Western Blot Nucleolin Antibody - BSA Free
(2 Reviews)
(26 Publications)
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IM, KD, Simple Western, WB
POT1 Antibody -
BSA Free
NB500-176
Western Blot POT1 Antibody - BSA Free
Western Blot POT1 Antibody - BSA Free
Western Blot POT1 Antibody - BSA Free
(1 Review)
(20 Publications)
Species: Hu
Applications: WB
CLN5 Antibody -
BSA Free
NBP1-94150
Western Blot CLN5 Antibody - BSA Free
Immunohistochemistry CLN5 Antibody - BSA Free
Immunohistochemistry CLN5 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
TRF-2 Antibody -
BSA Free
NB110-57130
Flow Cytometry TRF-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free
(2 Reviews)
(169 Publications)
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
CLN6 Antibody -
BSA Free
NBP2-39066
Western Blot CLN6 Antibody - BSA Free
Immunohistochemistry-Paraffin CLN6 Antibody - BSA Free
Species: Hu
Applications: IHC,  IHC-P, WB
CLN8 Antibody -
Azide and BSA Free
NBP2-92342
Western Blot CLN8 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin CLN8 Antibody - Azide and BSA Free
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
PCNA Antibody
(PC10) - BSA Free
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10) - BSA Free
Western Blot PCNA Antibody (PC10) - BSA Free
Flow Cytometry PCNA Antibody (PC10) - BSA Free
(5 Reviews)
(48 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
TIN2 Antibody
(OTI2C12)
NBP3-45024
Immunohistochemistry TIN2 Antibody (OTI2C12)
Western Blot TIN2 Antibody (OTI2C12)
Western Blot TIN2 Antibody (OTI2C12)
Species: Hu, Mu, Rt
Applications: IHC, WB
Cathepsin D
Antibody [Unconjugate
AF1029
Immunohistochemistry Cathepsin D Antibody [Unconjugated]
Immunocytochemistry Cathepsin D Antibody [Unconjugated]
Western Blot Cathepsin D Antibody [Unconjugated]
(54 Publications)
Species: Mu
Applications: ICC, IHC, IP, WB
TBP like protein
TLP Antibody - BSA Fr ...
NBP2-49671
Immunohistochemistry-Paraffin TBP like protein TLP Antibody - BSA Free
Immunohistochemistry-Paraffin TBP like protein TLP Antibody - BSA Free
Immunohistochemistry-Paraffin TBP like protein TLP Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
ACD Antibody
(1D8-1B6) - Azide and ...
H00065057-M02
Western Blot ACD Antibody (1D8-1B6) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence ACD Antibody (1D8-1B6) - Azide and BSA Free
Immunohistochemistry-Paraffin ACD Antibody (1D8-1B6) - Azide and BSA Free
(1 Review)
(8 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
TERF2IP Antibody -
BSA Free
NB100-292
Immunohistochemistry-Paraffin TERF2IP Antibody - BSA Free
Immunoprecipitation TERF2IP Antibody - BSA Free
Western Blot TERF2IP Antibody - BSA Free
(23 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
Recombinant Human
Tripeptidyl-Peptidase ...
H00001200-Q01
Recombinant Human Tripeptidyl-Peptidase I/TPP1 Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Tripeptidyl-Peptidase I/TPP1 Partial Recombinant Protein (H00001200-Q01) (0)

There are no publications for Tripeptidyl-Peptidase I/TPP1 Partial Recombinant Protein (H00001200-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tripeptidyl-Peptidase I/TPP1 Partial Recombinant Protein (H00001200-Q01) (0)

There are no reviews for Tripeptidyl-Peptidase I/TPP1 Partial Recombinant Protein (H00001200-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tripeptidyl-Peptidase I/TPP1 Partial Recombinant Protein (H00001200-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tripeptidyl-Peptidase I/TPP1 Products

Research Areas for Tripeptidyl-Peptidase I/TPP1 Partial Recombinant Protein (H00001200-Q01)

Find related products by research area.

Blogs on Tripeptidyl-Peptidase I/TPP1

There are no specific blogs for Tripeptidyl-Peptidase I/TPP1, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Tripeptidyl-Peptidase I/TPP1 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TPP1