TPP1 Antibody (H00001200-D01P)
TPP1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CLN2 antibody, anti-TPP I antibody, anti-MGC21297 antibody, anti-LPIC antibody, anti-GIG1 antibody, |
|
|
TPP1 Antibody Summary: | | Gene: | TPP1 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | TPP1 - tripeptidyl peptidase I, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional TPP1 Products TPP1 Antibody Details: | Immunogen: | TPP1 (NP_000382.3, 1 a.a. ~ 563 a.a) full-length human protein. |
|---|
| Epitope: | MGLQACLLGLFALILSGKCSYSPEPDQRRT LPPGWVSLGRADPEEELSLTFALRQQNVER LSELVQAVSDPSSPQYGKYLTLENVADLVR PSPLTLHTVQKWLLAAGAQKCHSVITQDFL TCWLSIRQAELLLPGAEFHHYVGGPTETHV VRSPHPYQLPQALAPHVDFVGGLHRFPPTS SLRQRPEPQVTGTVGLHLGVTPSVIRKRYN LTSQDVGSGTSNNSQACAQFLEQYFHDSDL AQFMRLFGGNFAHQA |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (14) Exploring TPP1
|
Jump to: Images, Ask a Question
|
Working with TPP1
TPP1 Antibody Images (2) Western Blot analysis of TPP1 expression in transfected 293T cell line by TPP1 MaxPab rabbit polyclonal antibody.
Lane 1: TPP1 transfected lysate(61.20 KDa).
Lane 2: Non-transfected lysate.
|  TPP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TPP1 expression in human placenta. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about TPP1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| TPP1 Antibody | NBP1-85561 | Hu | IF, IHC-P, WB | (2) | | | | | TPP1 Antibody | H00001200-B01 | Hu | ELISA, IHC-P, WB | (4) | | | | | TPP1 Antibody | H00001200-B01P | Hu | ELISA, IHC-P, WB | (4) | | | | | TPP1 Antibody | NBP1-36742 | Bv, Ca, Hu | IF, PEP-ELISA | (1) | | | | | TPP1 Antibody (3B1) | H00001200-M01 | Hu | ELISA, IHC-P, WB | (3) | | | | | ... and 3 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
