Home » Products » Primary Antibodies » TPP1 Antibody (H00001200-B01) (0.05 ml)
 

TPP1 Antibody (H00001200-B01)

TPP1 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
(see alternate names)
TPP1 Antibody Summary:
Species:Hu
Applications:ELISA, IHC-P, WB
Clonality:Polyclonal
Gene:TPP1
Purity:Whole antisera
Host:Mouse
Specificity:TPP1 - tripeptidyl peptidase I,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional TPP1 Products
LysatesPeptides and Proteins
Primary AntibodiesRNAi
 
» View all TPP1 Related Products
TPP1 Antibody Details:
Immunogen:TPP1 (NP_000382, 1 a.a. ~ 563 a.a) full-length human protein.
Epitope:MGLQACLLGLFALILSGKCSYSPEPDQRRT LPPGWVSLGRADPEEELSLTFALRQQNVER LSELVQAVSDPSSPQYGKYLTLENVADLVR PSPLTLHTVQKWLLAAGAQKCHSVITQDFL TCWLSIRQAELLLPGAEFHHYVGGPTETHV VRSPHPYQLPQALAPHVDFVGGLHRFPPTS SLRQRPEPQVTGTVGLHLGVTPSVIRKRYN LTSQDVGSGTSNNSQACAQFLEQYFHDSDL AQFMRLFGGNFAHQA
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Dilutions:ELISA, Western Blot 1:500, Immunohistochemistry-Paraffin
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: TPP1
Entrez1200 (Human)
Swiss ProtNP_000382 (Human)
 
Background:

This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
Images (4)
  • Western Blot analysis of TPP1 expression in transfected 293T cell line by TPP1 MaxPab polyclonal antibody (B01).<br><br>Lane 1: TPP1 transfected lysate(61.20 KDa).<br>Lane 2: Non-transfected lysate.<br>
  • Immunoperoxidase of <u>purified</u> MaxPab antibody to TPP1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
  • TPP1 MaxPab polyclonal antibody (B01), Lot # 07346 WULz. Western Blot analysis of TPP1 expression in human spleen.
  • TPP1 MaxPab polyclonal antibody. Western Blot analysis of TPP1 expression in Jurkat.

See all images...

Reviews (0)

Be the first to review this product for a reward!

Related Products (14)

2 Lysates

2 Peptides and Proteins

9 Primary Antibodies

1 RNAi

Secondary Antibodies

Exploring TPP1

1 Related Research Areas
Jump to: Images, Ask a Question

Working with TPP1

TPP1 Antibody Images (4)
Western Blot analysis of TPP1 expression in transfected 293T cell line by TPP1 MaxPab polyclonal antibody (B01).

Lane 1: TPP1 transfected lysate(61.20 KDa).
Lane 2: Non-transfected lysate.
Immunoperoxidase of purified MaxPab antibody to TPP1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
TPP1 MaxPab polyclonal antibody (B01), Lot # 07346 WULz. Western Blot analysis of TPP1 expression in human spleen.TPP1 MaxPab polyclonal antibody. Western Blot analysis of TPP1 expression in Jurkat.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.
Protocols
All General Protocols

Ask a Scientist

Can't find an answer to your question about TPP1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
TPP1 LysateH00001200-T01HuWB(2)

TPP1 LysateNBL1-17223WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
TPP1 Recombinant ProteinH00001200-P01HuELISA, WB(1)

TPP1 Partial Recombinant ProteinH00001200-Q01HuELISA, WB(1)

Primary Antibodies (9)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
TPP1 AntibodyNBP1-85561HuIF, IHC-P, WB(2)

TPP1 AntibodyH00001200-B01PHuELISA, IHC-P, WB(4)

TPP1 AntibodyNBP1-36742Bv, Ca, HuIF, PEP-ELISA(1)

TPP1 Antibody (3B1)H00001200-M01HuELISA, IHC-P, WB(3)

TPP1 AntibodyH00001200-D01PHuELISA, WB(2)

... and 4 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
TPP1 RNAiH00001200-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »
Jump to: Novus Explorer, Research Areas

TPP1 in Context

Research Areas related to TPP1 (1):
Novus Explorer for TPP1 gene
Try our bioinformatic tool that shows the relationships between TPP1 and other genes, diseases, pathways and post-translational modifications.