TPP1 Antibody (H00001200-M01)
TPP1 Antibody (3B1)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CLN2 antibody, anti-TPP-I antibody, anti-TPP I antibody, anti-LINCL antibody, anti-GIG1 antibody, |
|
|
TPP1 Antibody (3B1) Summary: | | Gene: | TPP1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | TPP1 - tripeptidyl peptidase I |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional TPP1 Products TPP1 Antibody (3B1) Details: | Clone: | 3B1 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | TPP1 (AAH14863, 195 a.a. ~ 305 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | GLHLGVTPSVIRKRYNLTSQDVGSGTSNNS QACAQFLEQYFHDSDLAQFMRLFGGNFAHQ ASVARVVGQQGRGRAGIEASLDVQYLMSAG ANISTWVYSSPGRHEGQEPF* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|---|
| Dilutions: | ELISA,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
|
Images (3) Reviews (0) Related Products (14) Exploring TPP1
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| TPP1 Antibody | NBP1-85561 | Hu | IF, IHC-P, WB | (2) | | | | | TPP1 Antibody | H00001200-B01 | Hu | ELISA, IHC-P, WB | (4) | | | | | TPP1 Antibody | H00001200-B01P | Hu | ELISA, IHC-P, WB | (4) | | | | | TPP1 Antibody | NBP1-36742 | Bv, Ca, Hu | IF, PEP-ELISA | (1) | | | | | TPP1 Antibody | H00001200-D01 | Hu | Func, IP, WB | | | | | | ... and 3 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of monoclonal antibody to TPP1 ( Cat # H00001200-M01 ) on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00001200-M01-3-6-1-S.jpg "Immunoperoxidase of monoclonal antibody to TPP1 ( Cat # H00001200-M01 ) on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]")
