TDG Partial Recombinant Protein 10 ug

Click image to view larger
Download Datasheet
See All Related

Ordering Information: H00006996-Q01

  • Catalog Number
    H00006996-Q01
  • Size(s)
  • Availability
  • Price
    Shipping
  

TDG Partial Recombinant Protein Summary

Description
TDG (Human) Recombinant Protein (Q01)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESH
Species Human
Tested Applications WB, ELISA, PA
Gene
TDG
Preparation
Method
in vitro wheat germ expression system
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.

Species Reactivity

Human

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Protein Array
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for TDG Partial Recombinant Protein (H00006996-Q01). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using TDG Partial Recombinant Protein (H00006996-Q01).

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Formulation
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Unit Size
10 ug
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

Gene Symbol TDG
Entrez

Alternate Names for TDG Partial Recombinant Protein

  • EC 3.2.2.29
  • thymine-DNA glycosylaseG/T mismatch-specific thymine DNA glycosylase

Related Products by Gene

Background

TDG - thymine-DNA glycosylase

Reviews for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no reviews for TDG Partial Recombinant Protein (H00006996-Q01).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used TDG Partial Recombinant Protein (H00006996-Q01)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for TDG Partial Recombinant Protein (H00006996-Q01) (0)

There are no publications for TDG Partial Recombinant Protein (H00006996-Q01).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using TDG Partial Recombinant Protein (H00006996-Q01)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for TDG (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Viewed This Item Also Viewed...

NB600-1031
Western Blot: uracil-DNA glycosylase Antibody [NB600-1031] - Analysis of UNG in HeLa cell lysate with using this antibody at 2 ug/ml.Immunohistochemistry-Paraffin: uracil-DNA glycosylase Antibody [NB600-1031] - Analysis of human testis using this antibody at 10 ug/ml.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF, IHC-P

4 Publications
NBP2-24393
Western Blot: MBD4 Antibody [NBP2-24393] - analysis of MBD4 in Jurkat cell lysate (30ug) using anti-MBD4 antibody followed by goat anti-rabbit HRP conjugated secondary antibody (Cat. #NB7160). Image from verified customer review. Western Blot: MBD4 Antibody [NBP2-24393] - Analysis of MBD4 in HL60 cell lysate probed with MBD4 antibody.

Rabbit Polyclonal
Species Human
Applications WB

2 Publications
NB100-116
Western Blot: APE Antibody (13B8E5C2) [NB100-116] - Ovarian Cancer cell lines.Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) [NB100-116] - HeLa cells stained NB100-116 (Green) detected with DyLight Fluor 488 conjugated anti-rabbit IgG secondary antibody. Nuclei are counterstained with Hoechst 33258 (Blue).Immunohistochemistry-Paraffin: APE Antibody (13B8E5C2) [NB100-116] - APE1 antibody was tested in human breast cancer xenograft using DAB with hematoxylin counterstain.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ChIP...MORE

     2 Reviews

68 Publications
NB100-1414
Western Blot: SMUG1 Antibody [NB100-1414] - (0.5ug/ml) of Molt-4 lysate (RIPA buffer, 35ug total protein per lane). Primary incubated for 1 hour. Detected by western blot using chemiluminescence.

Goat Polyclonal
Species Human
Applications WB, PEP-ELISA

2 Publications
AF1152
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Galectin‑1 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Galectin‑1 at approximately 17 kDa (as indicated) using 1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system. Galectin‑1 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using 1.7 µg/mL Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

Goat Polyclonal
Species Human
Applications WB, Simple Western, IHC...MORE

     3 Reviews

3 Publications
NBP1-87405
Western Blot: DNA Ligase IV Antibody [NBP1-87405] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spImmunocytochemistry/Immunofluorescence: DNA Ligase IV Antibody [NBP1-87405] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli, plasma membrane, cytoplasm & focal adhesions.Immunohistochemistry-Paraffin: DNA Ligase IV Antibody [NBP1-87405] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

1 Publication
MAB1489
Western blot shows lysates of MCF‑7 human breast cancer cell line untreated (-) or treated (+) with 1 µM Camptothecin (CPT) for 5 hours. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Human Phospho-p53 (S46) Monoclonal Antibody (Catalog # MAB1489) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for phospho-p53 (S46) at approximately 53 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Rabbit Monoclonal
Species Human
Applications WB

NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Sample (50 ug of whole cell lysate) A: Mouse brain 5% SDS PAGE, antibody diluted at 1:2000.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF, IHC...MORE

     1 Review

4 Publications
MAB2959R
SUMO3 was detected in immersion fixed HEK293 human embryonic kidney cell line using Recombinant Rat Anti-Human SUMO3 Monoclonal Antibody (Catalog # MAB2959R) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.


Species Human
Applications ICC

NBP1-36638
Immunohistochemistry: Thymidylate Synthase Antibody [NBP1-36638] - IHC analysis of Thymidylate Synthase in human pancreatic tumor. Image courtesy of anonymous customer product review.Immunohistochemistry-Paraffin: Thymidylate Synthase Antibody [NBP1-36638] Human Colon Carcinoma.

Rabbit Polyclonal
Species Human
Applications IHC, IHC-P

     1 Review

H00004350-M04
Western Blot: MPG Antibody (1E10) [H00004350-M04] - Analysis of MPG expression in Hela S3 NE (Cat # L013V3).Immunocytochemistry/Immunofluorescence: MPG Antibody (1E10) [H00004350-M04] - Analysis of monoclonal antibody to MPG on HeLa cell. Antibody concentration 40 ug/mlImmunohistochemistry-Paraffin: MPG Antibody (1E10) [H00004350-M04] - Analysis of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

1 Publication
NBP1-30955
Western Blot: AICDA Antibody [NBP1-30955] - Sample (30 ug of whole cell lysate) A: 293T 12% SDS PAGE, antibody diluted at 1:500.Immunocytochemistry/Immunofluorescence: AICDA Antibody [NBP1-30955] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.Immunohistochemistry-Paraffin: AICDA Antibody [NBP1-30955] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, DB, ICC/IF...MORE

NB100-56519
Western Blot: DNMT1 Antibody (60B1220.1) [NB100-56519] - analysis of Dnmt1 in 2102EP (human embryonic carcinoma) in the A) absence and B) presence of immunizing peptide, recombinant human Dnmt1 protein in the C) absence and D) presence of immunizing peptide, NIH 3T3 (mouse embryonic fribroblast) in the E) absence and F) presence of immunizing peptide, and D3 (mouse embryonic stem cell) in the G) absence and H) presence of immunizing peptide using Dnmt1 antibody. this antibody. 5 ug/ml for testing the human cell line and 0.1 ug/ml was used for testing the recombinant protein and the mouse cell lines. ’s goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.Immunocytochemistry/Immunofluorescence: DNMT1 Antibody (60B1220.1) [NB100-56519] - Dnmt1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody dilution of 1:10 was used. Image objective 40x.Immunohistochemistry-Paraffin: DNMT1 Antibody (60B1220.1) [NB100-56519] - IHC-P validation of DNMT1 antibody (clone 60B1220.1) on formalin fixed and paraffin embedded tissue section of human hepatocellular carcinoma at 1:50 dilution.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ChIP...MORE

     2 Reviews

97 Publications
A-718
Western blot shows lysates of SUMO2/3. PVDF membrane was probed with 0.5 µg/mL of Rat Anti-Human SUMO2/3 Monoclonal Antibody (Catalog # A-718) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for SUMO2/3 at approximately 16-20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.    Western  blot shows lysates of Jurkat human acute T cell leukemia cell line and  MCF‑7 human breast cancer cell line. PVDF membrane was probed with  1 µg/mL of Rat Anti-Human SUMO2/3 Monoclonal Antibody (Catalog #  A-718) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody  (Catalog # HAF005).  A specific band was detected for SUMO2/3 at approximately 16 kDa (as  indicated). This experiment was conducted under reducing conditions and using  Immunoblot  Buffer Group 1.

Rat Monoclonal
Species Human
Applications WB

NBP2-27335
Western Blot: PARP Antibody (194C1439) [Azide Free] [NBP2-27335] - Western analysis using 293T lysates expressing PARP. Image from verified customer review.Western Blot: PARP Antibody (194C1439) [Azide Free] [NBP2-27335] - Analysis of cleaved PARP in staurosporine-treated Jurkat cells at various time points, using this antibody. The band corresponding to cleaved PARP is only seen in the treated samples. anti-mouse Ig HRP conjugate was used in this test.

Mouse Monoclonal
Species Human
Applications WB, Flow

     1 Review

4 Publications
NB100-381
Proximity Ligation Assay: CBP/KAT3A Antibody [NB100-381] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human ATM (NB100-271) and rabbit anti-human CBP (NB100-381). Image merged from DAPI (2ms) and Texs Red (200ms) exposures, 40X magnification.Proximity Ligation Assay: CBP/KAT3A Antibody [NB100-381] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human SMARCA4 (NBP2-22234) and rabbit anti-human CBP (NB100-381).  Image merged from DAPI (2ms) and Texs Red (200ms) exposures, 40X magnification.Proximity Ligation Assay: CBP/KAT3A Antibody [NB100-381] - Secondary-conjugate Duolink II PLA in Hela cells. goat anti-human HP1-beta (NB100-79774) and rabbit anti-human CBP (NB100-381).  Image merged from DAPI (2ms) and Texs Red (200ms) exposures, 40X magnification.

Rabbit Polyclonal
Species Human
Applications WB, ChIP, IP...MORE

     2 Reviews

Additional Products by Application

Additional TDG Partial Recombinant Protein Products