Recombinant Human TBP like protein TLP Protein

Name: Recombinant Human TBP like protein TLP Protein
Brand: Novus Biologicals
SKU: H00009519-Q01
Price: 449 USD
Availability: Discontinued

Submit a Review

Images

Product Details

Summary

Product Discontinued

Order Details

Catalog Number

H00009519-Q01
Availability

Product Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

Recombinant Human TBP like protein TLP Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acids 33239 of Human TBPL1 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKL
Preparation Method	in vitro wheat germ expression system
Protein/Peptide Type	Partial Recombinant Protein
Gene	TBPL1

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Application Notes	Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TBP like protein TLP Protein

21 kDa TBP-like protein
STUD21-kDA TBP-like protein
TATA box binding protein-related factor 2
TATA box-binding protein-like protein 1
TATA box-binding protein-related factor 2
TBP-like 1
TBP-like factor
TBP-like protein 1
TBP-related factor 2
TBP-related protein
TLFMGC:8389
TLP21
TLPMGC:9620
TRF2Second TBP of unique DNA protein
TRP

Background

TBPL1 - TBP-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tyrosinase
Antibody (JA52-11)

NBP2-67232

Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

Vanilloid R1/TRPV1
Antibody - BSA Free

NBP1-97417

Immunocytochemistry/ Immunofluorescence Vanilloid R1/TRPV1 Antibody - BSA Free

(1 Review)

(12 Publications)

Species: Hu, In, Mu, Pm, Rt

Applications: ICC/IF, IF, IHC (-), WB

TRF-2 Antibody -
BSA Free

NB110-57130

Immunocytochemistry/ Immunofluorescence TRF-2 Antibody - BSA Free

(2 Reviews)

(169 Publications)

Species: ChHa, Hu, Mu, Pm, Rt

Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

TRPA1 Antibody -
BSA Free

NB110-40763

Immunohistochemistry TRPA1 Antibody - BSA Free

Flow Cytometry TRPA1 Antibody - BSA Free

(2 Reviews)

(84 Publications)

Species: Gp, Hu, Mu, Rt, Ze

Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(58 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

TRF-1 Antibody
(57-6) - BSA Free

NB110-68281

Western Blot TRF-1 Antibody (57-6) - BSA Free

(7 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, Flow, ICC/IF, Simple Western, WB

TRPM8 Antibody -
BSA Free

NBP1-97311

Immunocytochemistry/ Immunofluorescence TRPM8 Antibody - BSA Free

Immunohistochemistry TRPM8 Antibody - BSA Free

(9 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

TRPC1 Antibody

NB100-98844

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

TRPV4 Antibody

NB110-74960

(6 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TRPC3 Antibody -
BSA Free

NBP1-77262

Immunohistochemistry-Paraffin TRPC3 Antibody - BSA Free

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

TRPC6 Antibody -
BSA Free

NBP1-77260

Immunohistochemistry TRPC6 Antibody - BSA Free

(3 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(31 Publications)

Species: Bv, Hu, Mu

Applications: ICC, IHC

LIGHT/TNFSF14
[Unconjugated]

664-LI

Bioactivity LIGHT/TNFSF14 [Unconjugated]

(21 Publications)

Species: Hu

Applications: BA

TRPM2 Antibody -
BSA Free

NB110-81601

(17 Publications)

Species: Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

TYRP1 Antibody -
BSA Free

NBP1-88370

(4 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Glutaminyl-peptide
Cyclotransferase/QPCT ...

NBP1-81838

Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody - BSA Free

Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody - BSA Free

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Calmodulin 2
Antibody - BSA Free

NBP2-14871

Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody - BSA Free

(1 Publication)

Species: Mu, Rt

Applications: ICC/IF, WB

Calmodulin
Antibody (2D1) - BSA

NB120-2860

(3 Publications)

Species: Ba, Bv, Ch, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Calmodulin 3
Antibody - BSA Free

NBP2-15669

Immunohistochemistry Whole-Mount Calmodulin 3 Antibody - BSA Free

(1 Publication)

Species: Mu, Rt, Ze

Applications: IHC-WhMt, IHC, WB

POMC Antibody

NB100-1533

(11 Publications)

Species: Hu, Mu, Po, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Publications for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01) (0)

There are no publications for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01) (0)

There are no reviews for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBP like protein TLP Products

Research Areas for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01)

Find related products by research area.

Blogs on TBP like protein TLP

There are no specific blogs for TBP like protein TLP, but you can read our latest blog posts.

Contact Information

Product PDFs

PDF Datasheet

Request CofA

Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human TBP like protein TLP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

TBPL1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human TBP like protein TLP Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human TBP like protein TLP Protein Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human TBP like protein TLP Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01) (0)

Reviews for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01) (0)

Product General Protocols

Video Protocols

FAQs for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01) (0)

Additional TBP like protein TLP Products

Research Areas for TBP like protein TLP Partial Recombinant Protein (H00009519-Q01)

Blogs on TBP like protein TLP

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics