TBP like protein TLP Antibody (H00009519-A01)
TBP like protein TLP Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-MGC:8389 antibody, anti-TRF2 antibody, anti-TLP antibody, anti-TLF antibody, anti-STUD antibody, anti-MGC:9620 antibody, |
|
|
TBP like protein TLP Antibody Summary: | | Gene: | TBPL1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | TBPL1 - TBP-like 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional TBP like protein TLP Products TBP like protein TLP Antibody Details: | Immunogen: | TBPL1 (NP_004856, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | MDADSDVALDILITNVVCVFRTRCHLNLRK IALEGANVIYKRDVGKVLMKLRKPRITATI WSSGKIICTGATSEEEAKFGARRLARSLQK L* |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that serves the same function as TBP and substitutes for TBP at some promoters that are not recognized by TFIID. It is essential for spermiogenesis and believed to be important in expression of developmentally regulated genes.
|
Reviews (0) Related Products (8)
|
Jump to: Ask a Question
|
Working with TBP like protein TLP
TBP like protein TLP Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about TBP like protein TLP? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| TBP like protein TLP in Context
|
Novus Explorer for TBP like protein TLP gene
|
|
