Syntaxin-6 Antibody (H00010228-M01)
Syntaxin-6 Antibody (1G2)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-STX6 antibody, anti-syntaxin 6antibody, anti-HGNC:11441 antibody, |
|
|
Syntaxin-6 Antibody (1G2) Summary: | | Gene: | STX6 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | STX6 - syntaxin 6 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Syntaxin-6 Products Syntaxin-6 Antibody (1G2) Details: | Clone: | 1G2 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | STX6 (AAH09944, 1 a.a. ~ 256 a.a) full length recombinant protein with GST tag. |
|---|
| Marker: | Golgi Apparatus Marker |
|---|
| Epitope: | MSMEDPFFVVKGEVQKAVNTAQGLFQRWTE LLQDPSTATREEIDWTTNELRNNLRSIEWD LEDLDETISIVEANPRKFNLDATELSIRKA FITSTRQVVRDMKDQMSTSSVQALAERKNR QALLGDSGSQNWSTGTTDKYGRLDRELQRA NSHFIEEQQAQQQLIVEQQDEQLELVSGSI GVLKNMSQRIGGELEEQAVMLEDFSHELES TQSRLDNVMKKLAKVSHMTSDRRQWCAIAI LFAVLLVVLILFLVL |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (5) Reviews (0) Related Products (8) Exploring Syntaxin-6
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of monoclonal antibody to STX6 ( Cat # H00010228-M01 ) on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3ug/ml]](http://images.novusbio.com/images/H00010228-M01-3-27-1-S.jpg "Immunoperoxidase of monoclonal antibody to STX6 ( Cat # H00010228-M01 ) on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3ug/ml]")
![Immunofluorescence of monoclonal antibody to STX6 (H00010228-M01) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00010228-M01-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to STX6 (H00010228-M01) on HeLa cell . [antibody concentration 10 ug/ml]")
