We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Pentraxin 2/SAP Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Pentraxin 2/SAP Peptides and Proteins

Order Details


    • Catalog Number
      H00000325-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Pentraxin 2/SAP Protein Summary

Description
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-115 of Human APCS partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTDHVNLITPLEKPLQNFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVIEKFPAPVHICVSWESSSGIAEFWINGTPLVKKGLRQGYFVEAQPK

Protein/Peptide Type
Partial Recombinant Protein
Gene
APCS

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pentraxin 2/SAP Protein

  • 9.5S alpha-1-glycoprotein
  • amyloid P component, serum
  • APCS
  • MGC88159
  • Pentraxin 2
  • PTX2
  • PTX2serum amyloid P-component
  • SAP
  • SAPpentaxin-related
  • Serum Amyloid P component

Background

The protein encoded by this gene is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the encoded protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo. This gene has multiple polyadenylation sites. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY1707
Species: Hu
Applications: ELISA
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
DY1826
Species: Hu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP2-33680
Species: Hu
Applications: IHC,  IHC-P
NBP2-85481
Species: Hu
Applications: IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-92897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91684
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF4330
Species: Mu
Applications: CyTOF-ready, Flow, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP

Publications for Pentraxin 2/SAP Partial Recombinant Protein (H00000325-Q02) (0)

There are no publications for Pentraxin 2/SAP Partial Recombinant Protein (H00000325-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 2/SAP Partial Recombinant Protein (H00000325-Q02) (0)

There are no reviews for Pentraxin 2/SAP Partial Recombinant Protein (H00000325-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pentraxin 2/SAP Partial Recombinant Protein (H00000325-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pentraxin 2/SAP Products

Blogs on Pentraxin 2/SAP

There are no specific blogs for Pentraxin 2/SAP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pentraxin 2/SAP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APCS