SREBP2 Antibody (H00006721-A01)
SREBP2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-SREBP2 antibody |
|
|
SREBP2 Antibody Summary: | | Gene: | SREBF2 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | SREBF2 - sterol regulatory element binding transcription factor 2 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SREBP2 Products SREBP2 Antibody Details: | Immunogen: | SREBF2 (AAH56158, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | QAFCKNLLERAIESLVKPQAKKKAGDQEEE SCEFSSALEYLKLLHSFVDSVGVMSPPLSR SSVLKSALGPDIICRWWTSAITVAISWLQG DDAAVRSHFT |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.
|
Images (1) Reviews (0) Related Products (9) Exploring SREBP2
|
Jump to: Images, Ask a Question
|
Working with SREBP2
SREBP2 Antibody Images (1) SREBF2 polyclonal antibody (A01), Lot # 051213JC01 Western Blot analysis of SREBF2 expression in IMR-32 ( Cat # L008V1 ). |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about SREBP2? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (6)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
