SREBP1 Antibody (H00006720-M02)
SREBP1 Antibody (4C11)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-SREBP1 antibody |
|
|
SREBP1 Antibody (4C11) Summary: | | Gene: | SREBF1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | SREBF1 (4C11) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SREBP1 Products SREBP1 Antibody (4C11) Details: | Clone: | 4C11 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | VTQLFREHLLERALNCVTQPNPSPGSADGD KEFSDALGYLQLLNSCSDAAGAPAYSFSIS SSMATTTGVDPVAKWWASLTAVVIHWLRRD EEAAERLCPL |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene.
|
Images (2) Reviews (0) Related Products (36) Exploring SREBP1
|
Jump to: Images, Ask a Question
|
Working with SREBP1
SREBP1 Antibody (4C11) Images (2) SREBF1 monoclonal antibody (M02), clone 4C11 Western Blot analysis of SREBF1 expression in COLO 320 HSR ( Cat # L020V1 ). |  Detection limit for recombinant GST tagged SREBF1 is approximately 0.03ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about SREBP1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (19)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SREBP1 Antibody (2A4) | NB600-582 | Hu, Mu, Rt, SyHa | WB | (1) | (8) | | | | SREBP1 Antibody | NB100-2215 | Bv, Gt, Hu, Mu, Po, Rt, Sh | WB | (1) | (1) | | | | SREBP1 Antibody | NB100-60545 | Bv, Ha, Hu, Mu, Po, Rt | WB | (1) | | | | | SREBP1 Antibody (4B10) | H00006720-M01 | Hu | ELISA, WB | (3) | | | | | SREBP1 Antibody (4G4) | H00006720-M03 | Hu | ELISA, WB | (2) | | | | | ... and 14 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
