SPANXB1 Antibody (H00728695-B01P)

SPANXB1 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
SPANXB1 Antibody Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Polyclonal
Gene:SPANXB1
Purity:Protein A purified
Host:Mouse
Specificity:Reacts with SPANX family, member B1.
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional SPANXB1 Products
SPANXB1 Antibody Details:
Immunogen:SPANXB1 (NP_115850.1, 1 a.a. ~ 103 a.a) full-length human protein.
Epitope:MGQQSSVRRLKRSVPCESNEANEANEANKT MPETPTGDSDPQPAPKKMKTSESSTILVVR YRRNVKRTSPEELVNDHARENRINPDQMEE EEFIEITTERPKK
Species Reactivity:

Human

Applications:
Uses:This antibody is reactive against transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500,
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Store at -20 °C. Avoid freeze-thaw cycles.
Buffer:1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: SPANXB1
Entrez728695 (Human)
Swiss ProtNP_115850.1 (Human)
 
Background:

Temporally regulated transcription and translation of several testis-specific genes is required to initiate the series of molecular and morphological changes in the male germ cell lineage necessary for the formation of mature spermatozoa. This gene is a member of the SPANX family of cancer/testis-associated genes, which are located in a cluster on chromosome X. The SPANX genes encode differentially expressed testis-specific proteins that localize to various subcellular compartments. This particular gene maps to chromosome X in a head-to-tail orientation with SPANX family member B2, which appears to be a duplication of the B1 locus. The SPANXB genes are unique members of this gene family, since they contain an additional 18 nt in their coding region compared to the majority of family members. Although the protein encoded by this gene contains consensus nuclear localization signals, the major site for subcellular localization of expressed protein is in the cytoplasmic droplets of ejaculated spermatozoa. This protein provides a biochemical marker for studying the unique structures in spermatazoa, while attempting to further define its role in spermatogenesis. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with SPANXB1

SPANXB1 Antibody Images (2)
Western Blot analysis of SPANXB1 expression in transfected 293T cell line by SPANXB1 MaxPab polyclonal antibody.

Lane 1: SPANXB1 transfected lysate(11.33 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence of purified MaxPab antibody to SPANXB1 on Hs 181.Tes cell. [antibody concentration 10 ug/ml]
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about SPANXB1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SPANXB1 LysateNBL1-16370WB(1)

SPANXB1 LysateH00728695-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SPANXB1 Recombinant ProteinH00728695-P01HuELISA, WB(1)

Primary Antibodies (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SPANXB1 Antibody (2E12)H00728695-M04AHuELISA, WB

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

SPANXB1 in Context


Novus Explorer for SPANXB1 gene

Try our bioinformatic tool that shows the relationships between SPANXB1 and other genes, diseases, pathways and post-translational modifications.