SP1 Antibody (H00006667-M03)
SP1 Antibody (4C8)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-SP1 antibody, anti-Transcription factor Sp1 antibody, anti-TFSP1 antibody, |
|
|
SP1 Antibody (4C8) Summary: | | Gene: | SP1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SP1 Products SP1 Antibody (4C8) Details: | Clone: | 4C8 |
|---|
| Isotype: | IgG1 |
|---|
| Immunogen: | SP1 (NP_612482, 89 a.a. ~ 199 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | GTGELDLTATQLSQGANGWQIISSSSGATP TSKEQSGSSTNGSNGSESSKNRTVSGGQYV VAAAPNLQNQQVLTGLPGVMPNIQYQVIPQ FQTVDGQQLQFAATGAQVQQ* |
|---|
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
| Positive Controls: | 1 Positive Controls |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (5) Reviews (0) Related Products (37) Exploring SP1
|
Jump to: Positive Controls, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPositive ControlsPeptides and ProteinsPrimary Antibodies (29)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SP1 Antibody (1A5) | H00006667-M02 | Mu, Rt | ELISA, IF, IHC-P, WB | (6) | | | | | SP1 Antibody | NB600-233 | Hu | IHC-P, IP, WB | (3) | (1) | | | | SP1 Antibody (4H6) | H00006667-M01 | Hu | ELISA, IF, IHC-P, WB | (5) | | | | | SP1 Antibody | NBP1-61413 | Hu, Mu, Rt | ELISA, IF, IHC, WB | (3) | | | | | SP1 Antibody | NBP1-62007 | Hu, Mu, Rt | ELISA, IF, IHC, WB | (3) | | | | | ... and 24 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of monoclonal antibody to SP1 ( Cat # H00006667-M03 ) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00006667-M03-3-36-1-S.jpg "Immunoperoxidase of monoclonal antibody to SP1 ( Cat # H00006667-M03 ) on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]")
![Immunoperoxidase of monoclonal antibody to SP1 ( Cat # H00006667-M03 ) on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00006667-M03-3-44-1-S.jpg "Immunoperoxidase of monoclonal antibody to SP1 ( Cat # H00006667-M03 ) on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 3 ug/ml]")
![Immunofluorescence of monoclonal antibody to SP1 (H00006667-M03) on HeLa cell . [antibody concentration 20 ug/ml]](http://images.novusbio.com/images/H00006667-M03-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to SP1 (H00006667-M03) on HeLa cell . [antibody concentration 20 ug/ml]")
