SAR1 Antibody (H00056681-B01)
SAR1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-SAR1 antibody, anti-SARA1 antibody, anti-Sara antibody, anti-Masra2 antibody, |
|
|
SAR1 Antibody Summary: | | Gene: | SAR1A |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | SAR1A - SAR1 gene homolog A (S. cerevisiae), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SAR1 Products SAR1 Antibody Details: | Immunogen: | SAR1A (AAH03658, 1 a.a. ~ 199 a.a) full-length human protein. |
|---|
| Epitope: | MSFIFEWIYNGFSSVLQFLGLYKKSGKLVF LGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYL PAINGIVFLVDCADHSRLVESKVELNALMT DETISNVPILILGNKIDRTDAISEEKLREI FGLYGQTTGKGNVTLKELNARPMEVFMCSV LKRQGYGEGFRWLSQYID* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
| Positive Controls: | 1 Positive Controls |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (1) Reviews (0) Related Products (12) Exploring SAR1
|
Jump to: Images, Ask a Question
|
Working with SAR1
SAR1 Antibody Images (1) Western Blot analysis of SAR1A expression in transfected 293T cell line by SAR1A MaxPab polyclonal antibody (B01).
Lane 1: SAR1A transfected lysate(21.19 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about SAR1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Positive Controls, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPositive ControlsLysates (3)Peptides and ProteinsPrimary Antibodies (6)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SAR1 Antibody | NBP1-80789 | Hu | IF, IHC-P, WB | (3) | | | | | SAR1 Antibody | NBP1-02306 | Hu, Mu, Rt | PEP-ELISA, WB | | (1) | | | | SAR1 Antibody | PAB11416 | Hu, Mu, Rt | ELISA, WB | | | | | | SAR1 Antibody (3G5) | H00056681-M01 | Hu | ELISA, WB | (1) | | | | | SAR1 Antibody | H00056681-B02 | Hu | ELISA, WB | (1) | | | |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
