SAR1 Antibody (H00056681-B01)

SAR1 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
SAR1 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:SAR1A
Purity:Whole antisera
Host:Mouse
Specificity:SAR1A - SAR1 gene homolog A (S. cerevisiae),
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional SAR1 Products
SAR1 Antibody Details:
Immunogen:SAR1A (AAH03658, 1 a.a. ~ 199 a.a) full-length human protein.
Epitope:MSFIFEWIYNGFSSVLQFLGLYKKSGKLVF LGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYL PAINGIVFLVDCADHSRLVESKVELNALMT DETISNVPILILGNKIDRTDAISEEKLREI FGLYGQTTGKGNVTLKELNARPMEVFMCSV LKRQGYGEGFRWLSQYID*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Positive Controls:1 Positive Controls
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: SAR1A
Entrez56681 (Human)
Swiss ProtAAH03658 (Human)
 
Jump to: Images, Ask a Question

Working with SAR1

SAR1 Antibody Images (1)
Western Blot analysis of SAR1A expression in transfected 293T cell line by SAR1A MaxPab polyclonal antibody (B01).

Lane 1: SAR1A transfected lysate(21.19 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about SAR1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Positive Controls, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Positive Controls
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAR1 LysateH00056681-T01HuWB(2)

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAR1 LysateH00056681-T01HuWB(2)

SAR1 LysateNBL1-15691WB(1)

SAR1 LysateH00056681-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAR1 Recombinant ProteinH00056681-P01HuELISA, WB(1)

SAR1 ProteinNBP1-30177ELISA, PAGE(1)

Primary Antibodies (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAR1 AntibodyNBP1-80789HuIF, IHC-P, WB(3)

SAR1 AntibodyNBP1-02306Hu, Mu, RtPEP-ELISA, WB(1)

SAR1 AntibodyPAB11416Hu, Mu, RtELISA, WB

SAR1 Antibody (3G5)H00056681-M01HuELISA, WB(1)

SAR1 AntibodyH00056681-B02HuELISA, WB(1)

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAR1 RNAiH00056681-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

SAR1 in Context


Research Areas related to SAR1 (2):
Novus Explorer for SAR1 gene

Try our bioinformatic tool that shows the relationships between SAR1A and other genes, diseases, pathways and post-translational modifications.