SAR1 Antibody (3G5) Summary:

Species:	Hu
Applications:	ELISA, WB
Clonality:	Monoclonal

Gene:	SAR1A
Purity:	IgG purified
Host:	Mouse

Specificity:	SAR1A - SAR1 gene homolog A (S. cerevisiae) (3G5)

Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.

View Additional SAR1 Products

Lysates	Peptides and Proteins
Primary Antibodies	RNAi

» View all SAR1 Related Products

SAR1 Antibody (3G5) Details:

Clone:	3G5
Isotype:	IgG2b Kappa
Immunogen:	SAR1A (AAH03658, 1 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:	MSFIFEWIYNGFSSVLQFLGLYKKSGKLVF LGLDNAGKTTLLHMLKDDRLGQHVPTLHPT SEELTIAGMTFTTFDLGGHEQARRVWKNYL PAINGIVFLVDCADHSRLVESKVELNALMT DETISNVPILILGNKIDRTDAISEEKLREI FGLYGQTTGKGNVTLKELNARPMEVFMCSV LKRQGYGEGFRWLSQYID*

Species Reactivity:

Human.

Applications:

Uses:	Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Dilutions:	ELISA, Western Blot 1:500
Unit Size:	0.1 mg
Concentration:	Please see the vial label for concentration.

Notes:

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging:

Storage:	Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:	In 1x PBS, pH 7.2
Preservative:	No Preservative
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: SAR1A

Entrez	56681 (Human)
Swiss Prot	AAH03658 (Human)

Images (1)

See all images...

Reviews (0)

Be the first to review this product for a reward!

Working with SAR1

SAR1 Antibody (3G5) Images (1)

SAR1A monoclonal antibody (M01), clone 3G5. Western Blot analysis of SAR1A expression in Jurkat ( Cat # L017V1 ).

Reviews (0) Have you used this product? Review this product to earn Novus Rewards.

Protocols

All General Protocols

Ask a Scientist

Can't find an answer to your question about SAR1? Ask us by using live chat or by submitting your questions below:

Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (3)

Name	Catalog#	Reactivity	Applications	Images
SAR1 Lysate	H00056681-T01	Hu	WB	(2)
SAR1 Lysate	NBL1-15691		WB	(1)
SAR1 Lysate	H00056681-T02		WB

Peptides and Proteins

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
SAR1 Recombinant Protein	H00056681-P01	Hu	ELISA, WB	(1)
SAR1 Protein	NBP1-30177		ELISA, PAGE	(1)

Primary Antibodies (6)

Name	Catalog#	Reactivity	Applications	Images	Publications
SAR1 Antibody	NBP1-80789	Hu	IF, IHC-P, WB	(3)
SAR1 Antibody	NBP1-02306	Hu, Mu, Rt	PEP-ELISA, WB		(1)
SAR1 Antibody	PAB11416	Hu, Mu, Rt	ELISA, WB
SAR1 Antibody	H00056681-B01	Hu	ELISA, WB	(1)
SAR1 Antibody	H00056681-B02	Hu	ELISA, WB	(1)

RNAi (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
SAR1 RNAi	H00056681-R01	Hu		(1)	(4)

Secondary Antibodies

Name	Catalog#	Reactivity	Applications	Publications
Mouse IgG Antibody [Biotin]	NB720-B	Mu	ELISA, IHC-P, WB
Mouse IgG Antibody [HRP]	NB720-H	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [Alkaline Phosphatase]	NB720-AP	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [FITC]	NB720-F	Mu	ICC, IHC-P	(2)
Mouse IgG Antibody	NB120-7056	Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)	ELISA, IHC-P, IP, WB
See All »

Jump to: Novus Explorer, Research Areas

SAR1 in Context

Research Areas related to SAR1 (1):

Signal Transduction

Novus Explorer for SAR1 gene

Try our bioinformatic tool that shows the relationships between SAR1A and other genes, diseases, pathways and post-translational modifications.

SAR1 Antibody (H00056681-M01)

SAR1 Antibody (3G5)