Home » p38 gamma/SAPK3 » p38 gamma Peptides and Proteins » Recombinant Human p38 gamma/SAPK3 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human p38 gamma/SAPK3 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related p38 gamma/SAPK3 Peptides and Proteins

Order Details


    • Catalog Number
      H00006300-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human p38 gamma/SAPK3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 251-367 of Human MAPK12 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAPK12

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p38 gamma/SAPK3 Protein

  • EC 2.7.11
  • ERK3
  • ERK-6
  • ERK6MAPK 12
  • Extracellular signal-regulated kinase 6
  • MAP kinase 12
  • MAP kinase p38 gamma
  • MAPK12
  • mitogen-activated protein kinase 12
  • mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase p38 gamma
  • p38 gamma
  • p38gamma
  • PRKM12
  • SAPK-3
  • SAPK3EC 2.7.11.24
  • Stress-activated protein kinase 3

Background

MAPK12 - mitogen-activated protein kinase 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK1 [p Thr202, p
Tyr204] [Biotin]
DYC1825-2
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
N/A ERK1 [p Thr202, p Tyr204] [Biotin]
(12 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(68 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
PSMC6 Antibody
(2C4) - Azide and BSA ...
H00005706-M02
Western Blot PSMC6 Antibody (2C4) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4) - Azide and BSA Free
Western Blot PSMC6 Antibody (2C4) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(52 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
SGSM3 Antibody -
BSA Free
NBP2-13304
Western Blot SGSM3 Antibody - BSA Free
Immunohistochemistry-Paraffin SGSM3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/ Immunofluorescence c-jun [p Ser63] Antibody (SY0297)
Immunocytochemistry/ Immunofluorescence c-jun [p Ser63] Antibody (SY0297)
Immunohistochemistry-Paraffin c-jun [p Ser63] Antibody (SY0297)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(850 Publications)
Species: Hu
Applications: BA
Crk Antibody
(3G11E8)
NBP2-37568
ELISA Crk Antibody (3G11E8)
Western Blot Crk Antibody (3G11E8)
Western Blot Crk Antibody (3G11E8)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(31 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AIMP2 Antibody -
BSA Free
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody - BSA Free
Immunohistochemistry-Paraffin AIMP2 Antibody - BSA Free
Immunohistochemistry-Paraffin AIMP2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AHSA1 Antibody
(1A2-A8) - Azide and ...
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8) - Azide and BSA Free
Sandwich ELISA AHSA1 Antibody (1A2-A8) - Azide and BSA Free
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Recombinant Human
IFI44 GST (N-Term) Pr ...
H00010561-P01
Other Recombinant Human IFI44 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for p38 gamma/SAPK3 Partial Recombinant Protein (H00006300-Q01) (0)

There are no publications for p38 gamma/SAPK3 Partial Recombinant Protein (H00006300-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 gamma/SAPK3 Partial Recombinant Protein (H00006300-Q01) (0)

There are no reviews for p38 gamma/SAPK3 Partial Recombinant Protein (H00006300-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p38 gamma/SAPK3 Partial Recombinant Protein (H00006300-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p38 gamma/SAPK3 Products

Research Areas for p38 gamma/SAPK3 Partial Recombinant Protein (H00006300-Q01)

Find related products by research area.

Blogs on p38 gamma/SAPK3

There are no specific blogs for p38 gamma/SAPK3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human p38 gamma/SAPK3 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MAPK12