SAPK3 Antibody (H00006300-D01P)
SAPK3 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ERK3 antibody, anti-SAPK-3 antibody, anti-SAPK3 antibody, anti-PRKM12 antibody, anti-P38GAMMA antibody, anti-ERK6 antibody, |
|
|
SAPK3 Antibody Summary: | | Gene: | MAPK12 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | MAPK12 - mitogen-activated protein kinase 12, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SAPK3 Products SAPK3 Antibody Details: | Immunogen: | MAPK12 (NP_002960.2, 1 a.a. ~ 367 a.a) full-length human protein. |
|---|
| Epitope: | MSSPPPARSGFYRQEVTKTAWEVRAVYRDL QPVGSGAYGAVCSAVDGRTGAKVAIKKLYR PFQSELFAKRAYRELRLLKHMRHENVIGLL DVFTPDETLDDFTDFYLVMPFMGTDLGKLM KHEKLGEDRIQFLVYQMLKGLRYIHAAGII HRDLKPGNLAVNEDCELKILDFGLARQADS EMTGYVVTRWYRAPEVILNWMRYTQTVDIW SVGCIMAEMITGKTLFKGSDHLDQLKEIMK VTGTPPAEFVQRLQS |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (21) Exploring SAPK3
|
Jump to: Images, Ask a Question
|
Working with SAPK3
SAPK3 Antibody Images (1) Western Blot analysis of MAPK12 expression in transfected 293T cell line by MAPK12 MaxPab rabbit polyclonal antibody.
Lane 1: MAPK12 transfected lysate(41.90 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about SAPK3? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (1)Peptides and ProteinsPrimary Antibodies (12)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SAPK3 Antibody (10E1) | NBP1-47852 | Hu | FACS, IHC-P, WB | (3) | | | | | SAPK3 Antibody (4F4-3D2) | H00006300-M01 | Hu | ELISA, IF, WB | (3) | | | | | SAPK3 Antibody (1G3) | H00006300-M06 | Hu | ELISA, IF, WB | (2) | | | | | SAPK3 Antibody (1B3) | H00006300-M05 | Hu | ELISA, IF, WB | (2) | | | | | SAPK3 Antibody (1G4) | H00006300-M03 | Hu | ELISA, IHC-P, WB | (2) | | | | | ... and 7 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
