SAPK3 Antibody (H00006300-M02)
SAPK3 Antibody (1A4)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ERK3 antibody, anti-SAPK-3 antibody, anti-SAPK3 antibody, anti-PRKM12 antibody, anti-P38GAMMA antibody, anti-ERK6 antibody |
|
|
SAPK3 Antibody (1A4) Summary: | | Gene: | MAPK12 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | MAPK12 - mitogen-activated protein kinase 12 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SAPK3 Products SAPK3 Antibody (1A4) Details: | Clone: | 1A4 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | MAPK12 (AAH15741, 251 a.a. ~ 367 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | QRLQSDEAKNYMKGLPELEKKDFASILTNA SPLAVNLLEKMLVLDAEQRVTAGEALAHPY FESLHDTEDEPQVQKYDDSFDDVDRTLDEW KRVTYKEVLSFKPPRQLGARVSKETPL* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal transducer during differentiation of myoblasts to myotubes.
|
Images (1) Reviews (0) Related Products (21) Exploring SAPK3
|
Jump to: Images, Ask a Question
|
Working with SAPK3
SAPK3 Antibody (1A4) Images (1) MAPK12 monoclonal antibody (M02), clone 1A4 Western Blot analysis of MAPK12 expression in PC-12 ( Cat # L012V1 ). |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about SAPK3? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (1)Peptides and ProteinsPrimary Antibodies (12)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SAPK3 Antibody (10E1) | NBP1-47852 | Hu | FACS, IHC-P, WB | (3) | | | | | SAPK3 Antibody (4F4-3D2) | H00006300-M01 | Hu | ELISA, IF, WB | (3) | | | | | SAPK3 Antibody (1G3) | H00006300-M06 | Hu | ELISA, IF, WB | (2) | | | | | SAPK3 Antibody (1B3) | H00006300-M05 | Hu | ELISA, IF, WB | (2) | | | | | SAPK3 Antibody (1G4) | H00006300-M03 | Hu | ELISA, IHC-P, WB | (2) | | | | | ... and 7 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
