SAM68 Antibody

Name: SAM68 Antibody
Brand: Novus Biologicals
SKU: NBP1-58262
Price: 329 USD
Availability: Discontinued

Submit a Review

Images

Product Details

Summary

Product Discontinued

Order Details

Catalog Number

NBP1-58262
Availability

Product Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

SAM68 Antibody Summary

Immunogen	Synthetic peptides corresponding to KHDRBS1(KH domain containing, RNA binding, signal transduction associated 1) The peptide sequence was selected from the N terminal of KHDRBS1. Peptide sequence LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYL
Predicted Species	Mouse (93%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	KHDRBS1
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	Immunohistochemistry Western Blot 1:100-1:2000
Application Notes	This is a rabbit polyclonal antibody against KHDRBS1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS & 2% Sucrose.
Preservative	0.09% Sodium Azide
Purity	Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SAM68 Antibody

FLJ34027
GAP-associated tyrosine phosphoprotein p62
KH domain containing, RNA binding, signal transduction associated 1
KH domain-containing, RNA-binding, signal transduction-associated protein 1
KHDRBS1
p21 Ras GTPase-activating protein-associated p62
p62
p68
SAM68
Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68)
Src-associated in mitosis 68 kDa protein

Background

KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p62/SQSTM1
Antibody (2C11) - Azi ...

H00008878-M01

Western Blot p62/SQSTM1 Antibody (2C11) - Azide and BSA Free

(9 Reviews)

(441 Publications)

Species: Bv, Ha, Hu, Mu, Rb, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

LC3A Antibody -
BSA Free

NB100-2331

(22 Reviews)

(312 Publications)

Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(11 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

DOK1 [p Tyr362]
Antibody - BSA Free

NB100-82112

Immunohistochemistry-Paraffin DOK1 [p Tyr362] Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

GTF2H1 Antibody
(1F12-1B5) - Azide an ...

H00002965-M01

Immunocytochemistry/ Immunofluorescence GTF2H1 Antibody (1F12-1B5) - Azide and BSA Free

Immunohistochemistry-Paraffin GTF2H1 Antibody (1F12-1B5) - Azide and BSA Free

(2 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB

Beclin 1 Antibody
- BSA Free

NB500-249

Simple Western Beclin 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Beclin 1 Antibody - BSA Free

(9 Reviews)

(167 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(48 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(45 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

XPB Antibody - BSA
Free

NB100-61060

(1 Review)

(3 Publications)

Species: Hu, Mu, Rb, V-Vi

Applications: ChIP, IP, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, Simple Western, WB

GTF2H3 Antibody -
BSA Free

NBP2-87539

Immunohistochemistry GTF2H3 Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, WB

ART4 Antibody -
BSA Free

NBP3-41185

Species: Hu, Rt

Applications: IHC, IHC-P, WB

GTF2H2 Antibody
(PCRP-GTF2H2-1B9)

NBP3-07348

Flow Cytometry GTF2H2 Antibody (PCRP-GTF2H2-1B9)

Immunocytochemistry/ Immunofluorescence GTF2H2 Antibody (PCRP-GTF2H2-1B9)

Species: Hu

Applications: Flow, ICC/IF, PA

TOR/mTOR [p
Ser2448] Antibody - B ...

NB600-607

Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free

Data TOR/mTOR [p Ser2448] Antibody - BSA Free

(2 Reviews)

(9 Publications)

Species: Hu, Rt

Applications: ELISA, IHC, IHC-P, WB

Nrf2 Antibody -
BSA Free

NBP1-32822

(4 Reviews)

(77 Publications)

Species: Al, Av, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

c-Fos Antibody
(2H2) - BSA Free

NBP2-50037

Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2) - BSA Free

(1 Review)

(25 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, KO, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(4 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

ARHGEF7 Antibody -
BSA Free

NBP1-88650

Immunohistochemistry-Paraffin ARHGEF7 Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, KD, WB

GTF2H4 Antibody -
Azide and BSA Free

H00002968-B01P

Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody - Azide and BSA Free

Species: Hu

Applications: ICC/IF, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(850 Publications)

Species: Hu

Applications: BA

Publications for SAM68 Antibody (NBP1-58262) (0)

There are no publications for SAM68 Antibody (NBP1-58262).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAM68 Antibody (NBP1-58262) (0)

There are no reviews for SAM68 Antibody (NBP1-58262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAM68 Antibody (NBP1-58262) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional SAM68 Products

Research Areas for SAM68 Antibody (NBP1-58262)

Find related products by research area.

Signal Transduction

Blogs on SAM68

There are no specific blogs for SAM68, but you can read our latest blog posts.

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our SAM68 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol	KHDRBS1
Uniprot	Q07666()

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

SAM68 Antibody

Species Glossary

Images

Product Details

Order Details

SAM68 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for SAM68 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SAM68 Antibody (NBP1-58262) (0)

Reviews for SAM68 Antibody (NBP1-58262) (0)

Product General Protocols

Video Protocols

FAQs for SAM68 Antibody (NBP1-58262) (0)

Secondary Antibodies

Isotype Controls

Additional SAM68 Products

Research Areas for SAM68 Antibody (NBP1-58262)

Blogs on SAM68

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics