SAM68 Antibody (H00010657-B01)
SAM68 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-am68 antibody, anti-p62 antibody, |
|
|
SAM68 Antibody Summary: | | Gene: | KHDRBS1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | KHDRBS1 - KH domain containing, RNA binding, signal transduction associated 1, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SAM68 Products SAM68 Antibody Details: | Immunogen: | KHDRBS1 (AAH10132, 1 a.a. ~ 381 a.a) human protein. |
|---|
| Epitope: | MQRRDDPAARMSRSSGRSGSMDPSGAHPSV RQTPSRQPPLPHRSRGGGGGSRGGARASPA TQPPPLLPPSATGPDATVGGPAPTPLLPPS ATASVKMEPENKYLPELMAEKDSLDPSFTH AMQLLTAEIEKIQKGDSKKDDEENYLDLFS HKNMKLKERVLIPVKQYPKFNFVGKILGPQ GNTIKRLQEETGAKISVLGKGSMRDKAKEE ELRKGGDPKYAHLNMDLHVFIEVFGPPCEA YALMAHAMEEVKKFL |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (1) Reviews (0) Related Products (16)
|
Jump to: Images, Ask a Question
|
Working with SAM68
SAM68 Antibody Images (1) Western Blot analysis of KHDRBS1 expression in transfected 293T cell line by KHDRBS1 MaxPab polyclonal antibody (B01).
Lane 1: KHDRBS1 transfected lysate(41.00 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about SAM68? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (1)Peptides and ProteinsPrimary Antibodies (11)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SAM68 Antibody | NBP1-19151 | Hu | IHC-Fr, IP, WB | (5) | | | | | SAM68 Antibody (EPR3232) | NBP1-95346 | Hu, Mu | FACS, ICC, IF, IHC-P, IP, WB | (3) | | | | | SAM68 Antibody (1A4) | H00010657-M03 | Hu | ELISA, IF, IHC-P, WB | (5) | | | | | SAM68 Antibody (EPR3231) | NBP1-40589 | Hu, Mu, Rt | ICC, IHC-P, WB | (3) | | | | | SAM68 Antibody | NBP1-80229 | Bv, Hu, Mu, Rt | WB | | | | | | ... and 6 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
