SAM68 Antibody (H00010657-A01)

SAM68 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
SAM68 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:KHDRBS1
Purity:Whole antisera
Host:Mouse
Specificity:KHDRBS1 - KH domain containing, RNA binding, signal transduction associated 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional SAM68 Products
SAM68 Antibody Details:
Immunogen:KHDRBS1 (AAH00717, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag.
Epitope:ILGPQGNTIKRLQEETGAKISVLGKGSMRD KAKEEELRKGGDPKYAHLNMDLHVFIEVFG PPCEAYALMAHAMEEVKKFLVPDMMDDICQ EQFLELSYLN
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: KHDRBS1
Entrez10657 (Human)
OMIM602489 (Human)
Swiss ProtAAH00717 (Human)
 
Jump to: Ask a Question

Working with SAM68

SAM68 Antibody Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about SAM68? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAM68 Antibody PairH00010657-PW1HuIP, WB

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAM68 LysateH00010657-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAM68 Partial Recombinant ProteinH00010657-Q01HuELISA, WB(1)

SAM68 Recombinant ProteinH00010657-P01HuELISA, WB(1)

Primary Antibodies (11)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAM68 AntibodyNBP1-19151HuIHC-Fr, IP, WB(5)

SAM68 Antibody (EPR3232)NBP1-95346Hu, MuFACS, ICC, IF, IHC-P, IP, WB(3)

SAM68 Antibody (1A4)H00010657-M03HuELISA, IF, IHC-P, WB(5)

SAM68 Antibody (EPR3231)NBP1-40589Hu, Mu, RtICC, IHC-P, WB(3)

SAM68 AntibodyNBP1-80229Bv, Hu, Mu, RtWB

... and 6 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
SAM68 RNAiH00010657-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

SAM68 in Context


Novus Explorer for SAM68 gene

Try our bioinformatic tool that shows the relationships between KHDRBS1 and other genes, diseases, pathways and post-translational modifications.