SAM68 Antibody (H00010657-M03)
SAM68 Antibody (1A4)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Sam68 antibody, anti-p62 antibody |
|
|
SAM68 Antibody (1A4) Summary: | | Gene: | KHDRBS1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | KHDRBS1 (1A4) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional SAM68 Products SAM68 Antibody (1A4) Details: | Clone: | 1A4 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | KHDRBS1 (AAH00717, 176 a.a. ~ 275 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | ILGPQGNTIKRLQEETGAKISVLGKGSMRD KAKEEELRKGGDPKYAHLNMDLHVFIEVFG PPCEAYALMAHAMEEVKKFLVPDMMDDICQ EQFLELSYLN |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (5) Reviews (0) Related Products (16)
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (1)Peptides and ProteinsPrimary Antibodies (11)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| SAM68 Antibody | NBP1-19151 | Hu | IHC-Fr, IP, WB | (5) | | | | | SAM68 Antibody (EPR3232) | NBP1-95346 | Hu, Mu | FACS, ICC, IF, IHC-P, IP, WB | (3) | | | | | SAM68 Antibody (EPR3231) | NBP1-40589 | Hu, Mu, Rt | ICC, IHC-P, WB | (3) | | | | | SAM68 Antibody | NBP1-80229 | Bv, Hu, Mu, Rt | WB | | | | | | SAM68 Antibody | NBP1-58262 | Hu | WB | (1) | | | | | ... and 6 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of monoclonal antibody to KHDRBS1 ( Cat # H00010657-M03 ) on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00010657-M03-3-8-1-S.jpg "Immunoperoxidase of monoclonal antibody to KHDRBS1 ( Cat # H00010657-M03 ) on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]")
![Immunofluorescence of monoclonal antibody to KHDRBS1 (H00010657-M03) on A-431 cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00010657-M03-4-4-1-S.jpg "Immunofluorescence of monoclonal antibody to KHDRBS1 (H00010657-M03) on A-431 cell . [antibody concentration 10 ug/ml]")
