Recombinant Human EN-RAGE/S100A12 Protein Summary
| Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 33604 of Human S100A12 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE |
Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
S100A12 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
This product is useful for Western Blot and ELISA. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human EN-RAGE/S100A12 Protein
Background
S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A12 is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. S100A12 is also a ligand for RAGE. Interaction with RAGE on mononuclear phagocytes, lymphocytes and endothelium triggers cellular activation. Nuclear factor kappa B--a key transcription factor for inflammatory events--is activated by S100A12/RAGE. S100A12 has also been shown to have anti-microbial properties.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Publications for EN-RAGE/S100A12 Recombinant Protein (H00006283-P02) (0)
There are no publications for EN-RAGE/S100A12 Recombinant Protein (H00006283-P02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EN-RAGE/S100A12 Recombinant Protein (H00006283-P02) (0)
There are no reviews for EN-RAGE/S100A12 Recombinant Protein (H00006283-P02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EN-RAGE/S100A12 Recombinant Protein (H00006283-P02) (0)
Additional EN-RAGE/S100A12 Products
Research Areas for EN-RAGE/S100A12 Recombinant Protein (H00006283-P02)
Find related products by research area.
|
Blogs on EN-RAGE/S100A12