RRM2 Antibody (1E1) 0.1 mg

Click image to view larger
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 expression in HeLa NE ( Cat # L013V3 ).
Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 on HeLa cell. [antibody concentration 10 ug/ml]
Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Immunoperoxidase of monoclonal antibody to RRM2 ( Cat # H00006241-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 expression in HepG2 ( Cat # L019V1 ).
ELISA: RRM2 Antibody (1E1) [H00006241-M01] - Detection limit for recombinant GST tagged RRM2 is approximately 0.03ng/ml as a capture antibody.
Download Datasheet
See All Related

Ordering Information: H00006241-M01

  • Catalog Number
    H00006241-M01
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 mg
  • Availability
  • Price
    Shipping
  

RRM2 Antibody (1E1) Summary

Species Human
Tested Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clonality
Monoclonal
Host
Mouse
Gene
RRM2
Purity
IgG purified
Specificity
RRM2 - ribonucleotide reductase M2 polypeptide
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

RRM2 Antibody (1E1) Details

Clone
1E1
Isotype
IgG1 Kappa
Immunogen
RRM2 (NP_001025, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRV LASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP IEYHDIWQMYKKAEASFWTAEEVDLS

Species Reactivity

Human. Other species not tested.
Publications Read Publications using H00006241-M01 in the following species:


Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00006241-M01 in the following applications:

  • 1 publication

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for RRM2 Antibody (H00006241-M01). Be the first to review this product and earn double rewards points!

Publications

RRM2 Antibody (H00006241-M01) has been mentioned in at least 4 publications.
Earn rewards if you have published using RRM2 Antibody (H00006241-M01).

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Phosphate buffered saline, pH 7.4
Unit Size
0.1 mg
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
No Preservative
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol RRM2
Entrez
OMIM
Uniprot

Alternate Names for RRM2 Antibody (1E1)

  • EC 1.17.4.1
  • R2
  • ribonucleoside-diphosphate reductase subunit M2
  • ribonucleotide reductase M2
  • ribonucleotide reductase M2 polypeptide
  • Ribonucleotide reductase small chain
  • Ribonucleotide reductase small subunit
  • RR2
  • RR2M
Show More

Related Products by Gene

Background

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Reviews for RRM2 Antibody (H00006241-M01) (0)

There are no reviews for RRM2 Antibody (H00006241-M01).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used RRM2 Antibody (H00006241-M01)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for RRM2 Antibody (H00006241-M01) (4)

Read what people are writing who have used RRM2 Antibody (H00006241-M01).

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 applications: WB.

Have you published using RRM2 Antibody (H00006241-M01)? Submit your review and earn rewards points which can be used for merchandise & discounts.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for RRM2 (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NBP2-20231
Western Blot: RRM1 Antibody [NBP2-20231] - Sample (30 ug of whole cell lysate) A: 293T 5% SDS PAGE gel, diluted at 1:2000.Immunocytochemistry/Immunofluorescence: RRM1 Antibody [NBP2-20231] - Green: RRM1 protein stained by RRM1 antibody. Blue: Hoechst 33342 staining.Immunohistochemistry-Paraffin: RRM1 Antibody [NBP2-20231] - Gastric carcinoma.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

MAB7446
Flow Cytometry CD1b Antibody (737249)

Mouse Monoclonal
Species Human
Applications Flow

NBP2-24472
Western Blot: CDCA7L Antibody [NBP2-24472] - Analysis of CDCA7L/RAM2 in HCT-116 cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) NIH 3T3 cell lysate using NBP2-24472 at 4 ug/ml and 2 ug/ml, respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.

Rabbit Polyclonal
Species Human, Primate
Applications WB

MAB6979
Western Blot CD1d Antibody (703335)

Mouse Monoclonal
Species Human
Applications WB




NB100-64852
Flow Cytometry: CD1a Antibody (NA1/34-HLK) [NB100-64852] - Staining of MOLT 4 cells with MOUSE ANTI HUMAN CD1a

Mouse Monoclonal
Species Human, Canine, Primate
Applications Flow, IHC, IHC-Fr

7 Publications
NLS5770
Immunohistochemistry-Paraffin: NR2E3 Antibody [NLS5770] - IHC staining of human retina.Immunohistochemistry: NR2E3 Antibody [NLS5770] - IHC analysis of Retina using NLS5770 at 30 ug/ ml.

Rabbit Polyclonal
Species Human
Applications IHC, IHC-P

NBP2-15195
Immunohistochemistry-Paraffin: Insulin Antibody (2D11-H5) [NBP2-15195] - Analysisof Insulin in formalin-fixed paraffin embedded human pancreas using Insulin antibody (1:500), peroxidase-conjugate and DAB chromogen. Note the cytoplasmic staining of cells.

Mouse Monoclonal
Species Human, Porcine, Bovine
Applications WB, ELISA, Flow...MORE

4 Publications



H00000292-B01P
Western Blot: Adenine Nucleotide Translocator 2 Antibody [H00000292-B01P] - SLC25A5 MaxPab polyclonal antibody. Western Blot analysis of SLC25A5 expression in human liver.Western Blot: Adenine Nucleotide Translocator 2 Antibody [H00000292-B01P] - analysis of SLC25A5 expression in transfected 293T cell line by SLC25A5 MaxPab polyclonal antibody. Lane 1: SLC25A5 transfected lysate (32.89 KDa). Lane 2: Non-transfected lysate.

Mouse Polyclonal
Species Human
Applications WB, ELISA

NB100-664
Western Blot: VEGF Antibody (VG1) [NB100-664] - HUVEC and 293T Cells tested at 1:1000. Image provided by verified customer review.Immunocytochemistry/Immunofluorescence: VEGF Antibody (VG1) [NB100-664] - MCF7 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with VEGF (VG1) NB100-664 at a 1:200 dilution overnight at 4 degrees Celsius and detected with Dylight 488 (Green). Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were detected with DAPI (Blue). Cells were imaged using a 40X objective.Immunohistochemistry-Paraffin: VEGF Antibody (VG1) [NB100-664] - Analysis of Vascular Endothelial GF formalin-fixed paraffin embedded human angiosarcoma.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ELISA, ICC/IF...MORE

     1 Review

24 Publications
NB600-41532

Goat Polyclonal
Species Mouse
Applications WB, ELISA, ICC/IF...MORE

22 Publications



AF1034
Western Blot Cathepsin C/DPPI Antibody [Unconjugated]Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]

Goat Polyclonal
Species Mouse
Applications WB, IHC

5 Publications
NBP1-88927
Immunocytochemistry/Immunofluorescence: BBS9 Antibody [NBP1-88927] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Rabbit Polyclonal
Species Human
Applications ICC/IF, IHC, IHC-P

NB120-8105
Western Blot: p53R2 Antibody [NB120-8105] - Western blot analysis of p53r2 expression in (A) A431 and (B) 3T3 cell lysates in the absence or (C) presence of blocking peptide with anti-p53r2 at 1 ug /ml.Immunohistochemistry: p53R2 Antibody [NB120-8105] - Immunohistochemistry of p53r2 in human lung tissue with anti-p53r2 at 1 ug/ml.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, IHC, IHC-P

3 Publications
NB100-64849

Mouse Monoclonal
Species Human
Applications Flow, IHC, IHC-Fr...MORE

NBP2-36776
Western Blot: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Lane 1: Marker [kDa]Lane 2:Human cell line U-251 MGImmunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U251 cell line with Anti-HNRNPC monoclonal antibody, showing distinct nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U2OS cell line with Anti-HNRNPC monoclonal antibody, showing distinct nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

Mouse Monoclonal
Species Human
Applications WB, ICC/IF, IHC

NB100-65423
Flow Cytometry: HLA DQ/DR Antibody (49.1) [NB100-65423] - Staining of sheep peripheral blood lymphocytes with MOUSE ANTI OVINE MHC CLASS II DQ/DR (POLYMORPHIC).

Mouse Monoclonal
Species Human, Bovine, Goat...MORE
Applications Flow, IHC, IHC-Fr...MORE

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications