RRM2 Antibody (1E1) 0.1 mg

Click image to view larger
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - Western Blot analysis of RRM2 expression in HeLa NE ( Cat # L013V3 ).
Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - Immunofluorescence of monoclonal antibody to RRM2 on HeLa cell . [antibody concentration 10 ug/ml]
Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Immunoperoxidase of monoclonal antibody to RRM2 ( Cat # H00006241-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - Western Blot analysis of RRM2 expression in HepG2 ( Cat # L019V1 ).
ELISA: RRM2 Antibody (1E1) [H00006241-M01] - Detection limit for recombinant GST tagged RRM2 is approximately 0.03ng/ml as a capture antibody.
Download Datasheet
See All Related

Ordering Information: H00006241-M01

  • Catalog Number
    H00006241-M01
  • Displayed Format
    Unconjugated
  • Other Formats
  • Size(s)
    0.1 mg
  • Availability
  • Price
    Shipping
  

RRM2 Antibody (1E1) Summary

Species Human
Tested Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clonality
Monoclonal
Host
Mouse
Gene
RRM2
Purity
IgG purified
Specificity
RRM2 - ribonucleotide reductase M2 polypeptide
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

RRM2 Antibody (1E1) Details

Clone
1E1
Isotype
IgG1 Kappa
Immunogen
RRM2 (NP_001025, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRV LASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP IEYHDIWQMYKKAEASFWTAEEVDLS

Species Reactivity

Human. Other species not tested.
Publications Read Publications using H00006241-M01 in the following species:


Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Other Available
Formats
7C Labeled H00006241-M01V2
Alexa Fluor (R) 405 Labeled H00006241-M01AF405
Alexa Fluor (R) 488 Labeled H00006241-M01AF488
Alexa Fluor (R) 647 Labeled H00006241-M01AF647
Alexa Fluor (R) 700 Labeled H00006241-M01AF700
Allophycocyanin Labeled H00006241-M01APC
DyLight 350 Labeled H00006241-M01UV
DyLight 405 Labeled H00006241-M01V
DyLight 405LS Labeled H00006241-M01V3
DyLight 488 Labeled H00006241-M01G
DyLight 680 Labeled H00006241-M01FR
DyLight 755 Labeled H00006241-M01IR
PE Labeled H00006241-M01PE
PerCP Labeled H00006241-M01PCP
Publications
Read Publications using
H00006241-M01 in the following applications:

  • 1 publication

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for RRM2 Antibody (H00006241-M01). Be the first to review this product and earn double rewards points!

Publications

RRM2 Antibody (H00006241-M01) has been mentioned in at least 4 publications.
Earn rewards if you have published using RRM2 Antibody (H00006241-M01).

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Phosphate buffered saline, pH 7.4
Unit Size
0.1 mg
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
No Preservative
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol RRM2
Entrez
OMIM
Uniprot

Alternate Names for RRM2 Antibody (1E1)

  • EC 1.17.4.1
  • R2
  • ribonucleoside-diphosphate reductase subunit M2
  • ribonucleotide reductase M2
  • ribonucleotide reductase M2 polypeptide
  • Ribonucleotide reductase small chain
  • Ribonucleotide reductase small subunit
  • RR2
  • RR2M
Show More

Related Products by Gene

Background

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Reviews for RRM2 Antibody (H00006241-M01) (0)

There are no reviews for RRM2 Antibody (H00006241-M01).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used RRM2 Antibody (H00006241-M01)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for RRM2 Antibody (H00006241-M01) (4)

Read what people are writing who have used RRM2 Antibody (H00006241-M01).

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 applications: WB.

Have you published using RRM2 Antibody (H00006241-M01)? Submit your review and earn rewards points which can be used for merchandise & discounts.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for RRM2 (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NBP2-20231
Western Blot: RRM1 Antibody [NBP2-20231] - Sample (30 ug of whole cell lysate) A: 293T 5% SDS PAGE gel, diluted at 1:2000.Immunohistochemistry-Paraffin: RRM1 Antibody [NBP2-20231] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:500 dilution.Western Blot: RRM1 Antibody [NBP2-20231] - A. 30 ug NIH-3T3 whole cell lysate/extract B. 30 ug Raw264. 7 whole cell lysate/extract C. 30 ug C2C12 whole cell lysate/extract5 % SDS-PAGE RRM1 antibody dilution: 1:1000.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

NBP1-86559
Western Blot: CD1b Antibody [NBP1-86559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419761)Immunohistochemistry-Paraffin: CD1b Antibody [NBP1-86559] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Rabbit Polyclonal
Species Human
Applications IHC-P, IHC, WB

NBP2-24472
Western Blot: CDCA7L Antibody [NBP2-24472] - Analysis of CDCA7L/RAM2 in HCT-116 cell lysate in the 1) absence and 2) presence of immunizing peptide and 3) NIH 3T3 cell lysate using NBP2-24472 at 4 ug/ml and 2 ug/ml, respectively. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.

Rabbit Polyclonal
Species Human, Primate
Applications WB

NBP1-43461
Flow Cytometry: CD1d Antibody (1B1) [NBP1-43461] - Staining of BALB/c splenocytes with 1.0 ug of Rat IgG2b Isotype Control Purified  (open histogram) or 1.0 ug of Anti-Mouse CD1d Purified (filled histogram) followed by Anti-Rat IgG FITC . Total viable cells were used for analysis.

Rat Monoclonal
Species Mouse
Applications FLOW, Func, IHC...MORE

1 Publication
NBP1-19532
Immunocytochemistry/Immunofluorescence: TNF alpha Antibody [NBP1-19532] - TNF alpha antibody was tested in A431 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Immunohistochemistry-Paraffin: TNF alpha Antibody [NBP1-19532] - Immunohistochemical staining of TNF alpha in mouse intestine.

Rabbit Polyclonal
Species Rat, Mouse, Human
Applications IHC-P, IHC, ICC/IF...MORE

     1 Review

4 Publications
NB100-64852
Flow Cytometry: CD1a Antibody (NA1/34-HLK) [NB100-64852] - Staining of MOLT 4 cells with MOUSE ANTI HUMAN CD1a

Mouse Monoclonal
Species Primate, Canine, Human
Applications IHC-Fr, IHC, FLOW

7 Publications
NBP2-22466
Western Blot: NR2E3 Antibody [NBP2-22466] - Whole rat eye extracts.

Rabbit Polyclonal
Species Human, Rat
Applications WB

NB600-1488
Immunohistochemistry-Paraffin: Insulin Antibody (K36aC10) [NB600-1488] - human pancreas tissue sections.

Mouse Monoclonal
Species Primate, Rabbit, Sheep...MORE
Applications RIA, IHC-P, IHC...MORE

NB600-1131
Western Blot: IL6 Antibody [NB600-1131] - Shows detection of a band ~21 kDa in size corresponding to anti-IL6 antibody. Molecular weight markers are also shown (MW). After transfer, the membrane was blocked for 30 minutes with 1% BSA-TBST. Detection occurred using peroxidase conjugated anti-Rabbit IgG secondary antibody diluted 1:40,000 in blocking buffer for 30 min at RT followed by reaction with FemtoMax ™ chemiluminescent substrate.Immunocytochemistry/Immunofluorescence: IL6 Antibody [NB600-1131] - IL-6 antibody was tested in Raw264.7 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).Immunohistochemistry-Paraffin: IL6 Antibody [NB600-1131] - IHC staining of IL6 in human bladder cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications IP, IHC-P, IHC...MORE

6 Publications
H00000292-B01P
Western Blot: Adenine Nucleotide Translocator 2 Antibody [H00000292-B01P] - SLC25A5 MaxPab polyclonal antibody. Western Blot analysis of SLC25A5 expression in human liver.Western Blot: Adenine Nucleotide Translocator 2 Antibody [H00000292-B01P] - analysis of SLC25A5 expression in transfected 293T cell line by SLC25A5 MaxPab polyclonal antibody. Lane 1: SLC25A5 transfected lysate (32.89 KDa). Lane 2: Non-transfected lysate.

Mouse Polyclonal
Species Human
Applications ELISA, WB

NB100-664
Western Blot: VEGF Antibody (VG1) [NB100-664] - HUVEC and 293T Cells tested at 1:1000. Image provided by verified customer review.Immunohistochemistry-Paraffin: VEGF Antibody (VG1) [NB100-664] - Analysis of Vascular Endothelial GF formalin-fixed paraffin embedded human angiosarcoma.Western Blot: VEGF Antibody (VG1) [NB100-664] - Western blot analysis of VEGF in human kidney protein using NB100-664.

Mouse Monoclonal
Species Canine, Rat, Mouse...MORE
Applications IHC-P, IHC-Fr, IHC...MORE

     1 Review

22 Publications
NB600-41532

Goat Polyclonal
Species Mouse
Applications IHC-P, IHC, ICC/IF...MORE

21 Publications
NBP1-58984
Western Blot: Complement C2 Antibody [NBP1-58984] - Human Heart lysate, concentration 0.2-1 ug/ml.

Rabbit Polyclonal
Species Porcine, Guinea Pig, Equine...MORE
Applications WB

NBP1-71418
Western Blot: DPP1 Antibody [NBP1-71418] - Analysis of extracts from Jurkat cells, treated with etoposide 25uM 1h, using DPP1 (heavy chain,Cleaved-Arg394) Antibody. The lane on the right is treated with the synthesized peptide.

Rabbit Polyclonal
Species Human
Applications WB, ELISA

NBP1-88927
Immunocytochemistry/Immunofluorescence: BBS9 Antibody [NBP1-88927] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.Immunohistochemistry-Paraffin: BBS9 Antibody [NBP1-88927] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.

Rabbit Polyclonal
Species Human
Applications IHC-P, IHC, ICC/IF

NB120-8105
Western Blot: p53R2 Antibody [NB120-8105] - Western blot analysis of p53r2 expression in (A) A431 and (B) 3T3 cell lysates in the absence or © presence of blocking peptide with anti-p53r2 at 1 ug /ml.Immunohistochemistry: p53R2 Antibody [NB120-8105] - Immunohistochemistry of p53r2 in human lung tissue with anti-p53r2 at 1 ug/ml.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, IHC, IHC-P

3 Publications
NBP2-31143
Western Blot: CTLA4 Antibody (37B3D8.2F2) [NBP2-31143] - WB analysis of CTLA-4 protein on (A) mouse Kidney lysate (B) human Kidney lysate and on © partial recombinant protein using CTLA-4 monoclonal antibody at a concentration of 2 ug/ml.

Mouse Monoclonal
Species Mouse, Human
Applications WB

NBP2-33604
Western Blot: hnRNP C1 + C2 Antibody [NBP2-33604] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG spImmunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody [NBP2-33604] - Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli.Immunohistochemistry-Paraffin: hnRNP C1 + C2 Antibody [NBP2-33604] - liver cancer

Rabbit Polyclonal
Species Human
Applications IHC-P, IHC, ICC/IF...MORE

NB100-65423
Flow Cytometry: HLA DQ/DR Antibody (49.1) [NB100-65423] - Staining of sheep peripheral blood lymphocytes with MOUSE ANTI OVINE MHC CLASS II DQ/DR (POLYMORPHIC).

Mouse Monoclonal
Species Human, Bovine, Goat...MORE
Applications FLOW, IHC, IHC-Fr...MORE

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Mouse, Human
Applications IP, IHC-P, IHC...MORE

     1 Review

12 Publications