RRM2 Antibody (1E1) 0.1 mg

RRM2 H00006241-M01

Contact Information

Choose a country to view pricing and purchasing information.

More on H00006241-M01

  • RRM2 Primary Antibodies
  • All RRM2 Products
  • 4 Publications
  • Alternate Names
     
  • Submit a Review

Ordering Information: H00006241-M01

Catalog NumberH00006241-M01
  • FormUnconjugated
  • Formats
  • Size(s)0.1 mg
  • Price, Shipping
    & Availability
     

     
  •  

RRM2 Antibody (1E1) Summary

 
Species Human
Tested Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clonality Monoclonal
Host Mouse
Gene RRM2
Purity IgG purified
Specificity RRM2 - ribonucleotide reductase M2 polypeptide
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

RRM2 Antibody (1E1) Details

 
Clone 1E1
Isotype IgG1 Kappa
Immunogen RRM2 (NP_001025, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGT RV LASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIF P IEYHDIWQMYKKAEASFWTAEEVDLS

Species Reactivity

 
Human. Other species not tested.
Publications Read Publications using H00006241-M01 in the following species:
 

Applications/Dilutions

 
Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes

Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Other Available
Formats
7C Labeled H00006241-M01V2
Alexa Fluor (R) 405 Labeled H00006241-M01AF405
Alexa Fluor (R) 488 Labeled H00006241-M01AF488
Alexa Fluor (R) 647 Labeled H00006241-M01AF647
Alexa Fluor (R) 700 Labeled H00006241-M01AF700
Allophycocyanin Labeled H00006241-M01APC
DyLight 350 Labeled H00006241-M01UV
DyLight 405 Labeled H00006241-M01V
DyLight 405LS Labeled H00006241-M01V3
DyLight 488 Labeled H00006241-M01G
DyLight 680 Labeled H00006241-M01FR
DyLight 755 Labeled H00006241-M01IR
PE Labeled H00006241-M01PE
PerCP Labeled H00006241-M01PCP
Learn about Custom Antibody Labeling
Publications
Read publication using
H00006241-M01 in the following applications:
  • WB1publications

Product PDFs

Reviews

Earn rewards points by submitting your review for RRM2 Antibody (H00006241-M01).
Submit a Review

Publications

RRM2 Antibody (H00006241-M01) has been mentioned in at least 4 publications.
Earn rewards if you have published using RRM2 Antibody (H00006241-M01).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all RRM2 Research Tools.

Notes

 
This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

 
Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer Phosphate buffered saline, pH 7.4
Unit Size 0.1 mg
Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol RRM2
Entrez
OMIM
Uniprot

Alternate Names for RRM2

 
  • EC 1.17.4.1
  • ribonucleoside-diphosphate reductase subunit M2
  • RR2
  • RR2M
  • Ribonucleotide reductase small subunit
  • R2
  • Ribonucleotide reductase small chain
  • ribonucleotide reductase M2 polypeptide
  • ribonucleotide reductase M2

Related Products by Gene

Background

 
Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.