RRM2 Antibody (1E1) 0.1 mg

Click image to view larger
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 expression in HeLa NE ( Cat # L013V3 ).
Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 on HeLa cell. [antibody concentration 10 ug/ml]
Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Immunoperoxidase of monoclonal antibody to RRM2 ( Cat # H00006241-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 expression in HepG2 ( Cat # L019V1 ).
ELISA: RRM2 Antibody (1E1) [H00006241-M01] - Detection limit for recombinant GST tagged RRM2 is approximately 0.03ng/ml as a capture antibody.
Download Datasheet
See All Related

Ordering Information: H00006241-M01

  • Catalog Number
    H00006241-M01
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 mg
  • Availability
  • Price
    Shipping
  

RRM2 Antibody (1E1) Summary

Species Human
Tested Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
Clonality
Monoclonal
Host
Mouse
Gene
RRM2
Purity
IgG purified
Specificity
RRM2 - ribonucleotide reductase M2 polypeptide
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

RRM2 Antibody (1E1) Details

Clone
1E1
Isotype
IgG1 Kappa
Immunogen
RRM2 (NP_001025, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRV LASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP IEYHDIWQMYKKAEASFWTAEEVDLS

Species Reactivity

Human. Other species not tested.
Publications Read Publications using H00006241-M01 in the following species:


Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00006241-M01 in the following applications:

  • 1 publication

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for RRM2 Antibody (H00006241-M01). Be the first to review this product and earn double rewards points!

Publications

RRM2 Antibody (H00006241-M01) has been mentioned in at least 4 publications.
Earn rewards if you have published using RRM2 Antibody (H00006241-M01).

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Phosphate buffered saline, pH 7.4
Unit Size
0.1 mg
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
No Preservative
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol RRM2
Entrez
OMIM
Uniprot

Alternate Names for RRM2 Antibody (1E1)

  • EC 1.17.4.1
  • R2
  • ribonucleoside-diphosphate reductase subunit M2
  • ribonucleotide reductase M2
  • ribonucleotide reductase M2 polypeptide
  • Ribonucleotide reductase small chain
  • Ribonucleotide reductase small subunit
  • RR2
  • RR2M
Show More

Related Products by Gene

Background

Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Reviews for RRM2 Antibody (H00006241-M01) (0)

There are no reviews for RRM2 Antibody (H00006241-M01).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used RRM2 Antibody (H00006241-M01)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for RRM2 Antibody (H00006241-M01) (4)

Read what people are writing who have used RRM2 Antibody (H00006241-M01).

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 applications: WB.

Have you published using RRM2 Antibody (H00006241-M01)? Submit your review and earn rewards points which can be used for merchandise & discounts.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for RRM2 (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)