RFC4 Antibody (H00005984-B01)

RFC4 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
RFC4 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:RFC4
Purity:Whole antisera
Host:Mouse
Specificity:RFC4 - replication factor C (activator 1) 4, 37kDa,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional RFC4 Products
RFC4 Antibody Details:
Immunogen:RFC4 (NP_002907, 1 a.a. ~ 363 a.a) full-length human protein.
Epitope:MQAFLKGTSISTKPPLTKDRGVAASAGSSG ENKKAKPVPWVEKYRPKCVDEVAFQEEVVA VLKKSLEGADLPNLLFYGPPGTGKTSTILA AARELFGPELFRLRVLELNASDERGIQVVR EKVKNFAQLTVSGSRSDGKPCPPFKIVILD EADSMTSAAQAALRRTMEKESKTTRFCLIC NYVSRIIEPLTSRCSKFRFKPLSDKIQQQR LLDIAKKENVKISDEGIAYLVKVSEGDLRK AITFLQSATRLTGGK
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Positive Controls:1 Positive Controls
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: RFC4
Entrez5984 (Human)
Swiss ProtNP_002907 (Human)
 
Background:

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.

Jump to: Images, Ask a Question

Working with RFC4

RFC4 Antibody Images (3)
Western Blot analysis of RFC4 expression in transfected 293T cell line by RFC4 MaxPab polyclonal antibody (B01).

Lane 1: RFC4 transfected lysate(39.70 KDa).
Lane 2: Non-transfected lysate.
RFC4 MaxPab polyclonal antibody (B01), Lot # 07304WULz. Western Blot analysis of RFC4 expression in human placenta.
RFC4 MaxPab polyclonal antibody. Western Blot analysis of RFC4 expression in HeLa.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about RFC4? Ask us by using live chat or by submitting your questions below:

 
Jump to: Positive Controls, Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Positive Controls
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 LysateH00005984-T01HuWB(2)

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 Antibody PairH00005984-PW1HuIP, WB

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 LysateH00005984-T01HuWB(2)

RFC4 LysateNBL1-15294WB(1)

RFC4 LysateH00005984-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 Recombinant ProteinH00005984-P01HuELISA, WB(1)

RFC4 Partial Recombinant ProteinH00005984-Q01HuELISA, WB(1)

Primary Antibodies (12)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 Antibody (1C12)H00005984-M01HuELISA, IHC-P, RNAi, WB(5)

RFC4 AntibodyNBP1-33083HuIF, IHC-P, WB(3)

RFC4 AntibodyNB100-234HuWB(1)(1)

RFC4 AntibodyNB100-403HuIP, WB

RFC4 AntibodyNB100-233HuWB(1)

... and 7 more. See All »
RNAi (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 RNAiH00005984-R01VHu(2)(4)

RFC4 RNAiH00005984-R04Hu(1)(4)

RFC4 RNAiH00005984-R03Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

RFC4 in Context


Research Areas related to RFC4 (2):
Novus Explorer for RFC4 gene

Try our bioinformatic tool that shows the relationships between RFC4 and other genes, diseases, pathways and post-translational modifications.