RFC4 Antibody (H00005984-M01)
RFC4 Antibody (1C12)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-A1 37 antibody, anti-RFC37 antibody, anti-RFC 37 antibody, anti-replication factor c4 antibody, anti-Replication factor C37 kDa subunit antibody, anti-Replication factor C 37 antibody, anti-Activator 137 kDa subunit antibody, anti-Activator 1 37 antibody, anti-A137 antibody, |
|
|
RFC4 Antibody (1C12) Summary: | | Gene: | RFC4 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | RFC4 - replication factor C (activator 1) 4, 37kDa |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional RFC4 Products RFC4 Antibody (1C12) Details: | Clone: | 1C12 |
|---|
| Isotype: | IgG Mix Kappa |
|---|
| Immunogen: | RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | GKEITEKVITDIAGVIPAEKIDGVFAACQS GSFDKLEAVVKDLIDEGHAATQLVNQLHDV VVENNLSDKQKSIITEKLAEVDKCLADGAD EHLQLISLCATVMQQLSQNC |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation, and ELISA. |
|---|
| Dilutions: | ELISA,
Immunohistochemistry-Paraffin,
Western Blot 1:500,
RNAi Validation |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.
|
Images (5) Reviews (0) Related Products (21) Exploring RFC4
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (3)Peptides and ProteinsPrimary Antibodies (12)RNAi (3)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of monoclonal antibody to RFC4 ( Cat # H00005984-M01 ) on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00005984-M01-3-5-1-S.jpg "Immunoperoxidase of monoclonal antibody to RFC4 ( Cat # H00005984-M01 ) on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]")
