RFC4 Antibody (H00005984-M02)

RFC4 Antibody (1B2)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
RFC4 Antibody (1B2) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:RFC4
Purity:IgG purified
Host:Mouse
Specificity:RFC4 - replication factor C (activator 1) 4, 37kDa (1B2)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional RFC4 Products
RFC4 Antibody (1B2) Details:
Clone:1B2
Isotype:IgG2a Kappa
Immunogen:RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:GKEITEKVITDIAGVIPAEKIDGVFAACQS GSFDKLEAVVKDLIDEGHAATQLVNQLHDV VVENNLSDKQKSIITEKLAEVDKCLADGAD EHLQLISLCATVMQQLSQNC
Species Reactivity:

Human.

Applications:
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: RFC4
Entrez5984 (Human)
Swiss ProtAAH17452 (Human)
 
Background:

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with RFC4

RFC4 Antibody (1B2) Images (1)
Detection limit for recombinant GST tagged RFC4 is approximately 0.3ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about RFC4? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 Antibody PairH00005984-PW1HuIP, WB

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 LysateH00005984-T01HuWB(2)

RFC4 LysateNBL1-15294WB(1)

RFC4 LysateH00005984-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 Recombinant ProteinH00005984-P01HuELISA, WB(1)

RFC4 Partial Recombinant ProteinH00005984-Q01HuELISA, WB(1)

Primary Antibodies (12)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 Antibody (1C12)H00005984-M01HuELISA, IHC-P, RNAi, WB(5)

RFC4 AntibodyNBP1-33083HuIF, IHC-P, WB(3)

RFC4 AntibodyNB100-234HuWB(1)(1)

RFC4 AntibodyNB100-403HuIP, WB

RFC4 AntibodyNB100-233HuWB(1)

... and 7 more. See All »
RNAi (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC4 RNAiH00005984-R01VHu(2)(4)

RFC4 RNAiH00005984-R04Hu(1)(4)

RFC4 RNAiH00005984-R03Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

RFC4 in Context


Research Areas related to RFC4 (2):
Novus Explorer for RFC4 gene

Try our bioinformatic tool that shows the relationships between RFC4 and other genes, diseases, pathways and post-translational modifications.