RFC2 Antibody (H00005982-B02P)
RFC2 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-A1 antibody, anti-RFC40 antibody, anti-MGC3665 antibody, |
|
|
RFC2 Antibody Summary: | | Gene: | RFC2 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | RFC2 - replication factor C (activator 1) 2, 40kDa, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional RFC2 Products RFC2 Antibody Details: | Immunogen: | RFC2 (NP_002905.2, 1 a.a. ~ 320 a.a) full-length human protein. |
|---|
| Epitope: | MEVEAVCGGAGEVEAQDSDPAPAFSKAPGS AGHYELPWVEKYRPVKLNEIVGNEDTVSRL EVFAREGNVPNIIIAGPPGTGKTTSILCLA RALLGPALKDAMLELNASNDSMTDGAQQAL RRTMEIYSKTTRFALACNASDKIIEPIQSR CAVLRYTKLTDAQILTRLMNVIEKERVPYT DDGLEAIIFTAQGDMRQALNNLQSTFSGFG FINSENVFKVCDEPHPLLVKEMIQHCVNAN IDEAYKILAHLWHLG |
|---|
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot and also on transfected lysate in Western Blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence and immunohistochemistry (paraf |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also called activator 1, is a protein complex consisting of five distinct subunits of 145, 40, 38, 37, and 36.5 kD. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP. Deletion of this gene has been associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq]
|
Images (5) Reviews (0) Related Products (14) Exploring RFC2
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (7)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of <u>purified</u> MaxPab antibody to RFC2 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00005982-B02P-3-10-1-S.jpg "Immunoperoxidase of <u>purified</u> MaxPab antibody to RFC2 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]")
![Immunofluorescence of <u>purified</u> MaxPab antibody to RFC2 on HeLa cell. [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00005982-B02P-4-1-1-S.jpg "Immunofluorescence of <u>purified</u> MaxPab antibody to RFC2 on HeLa cell. [antibody concentration 10 ug/ml]")
