RFC1 Antibody (H00005981-A01)
RFC1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-A1 P145 Activator 1 large subunit antibody, anti-RFC140 Replication Factor C 140 kDa subunit antibody, anti-RFC1 antibody, anti-Replication factor C1 antibody, anti-Replication factor C antibody, anti-RECC1 antibody, anti-MHCBFB antibody, anti-MHC binding factor beta antibody, anti-DNA binding Protein PO GA antibody, anti-Activator 1 140 kDa subunit antibody, |
|
|
RFC1 Antibody Summary: | | Gene: | RFC1 |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | RFC1 - replication factor C (activator 1) 1, 145kDa |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional RFC1 Products RFC1 Antibody Details: | Immunogen: | RFC1 (AAH51786, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | MDIRKFFGVIPSGKKLVSETVKKNEKTKSD EETLKAKKGIKEIKVNSSRKEDDFKQKQPS KKKRIIYDSDSESEETLQVKNAKKPPEKLP VSSKPGKISRQDPVTYISET |
|---|
Human. Other species not tested. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Unpurified antisera so the specific antibody concentration is unknown. Contains 50% glycerol. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.
|
Reviews (0) Related Products (7) Exploring RFC1
|
Jump to: Ask a Question
|
Working with RFC1
RFC1 Antibody Images (0)
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about RFC1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (5)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
