RFC1 Antibody (H00005981-M01)

RFC1 Antibody (3F8)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
RFC1 Antibody (3F8) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:RFC1
Purity:IgG purified
Host:Mouse
Specificity:RFC1 - replication factor C (activator 1) 1, 145kDa
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional RFC1 Products
RFC1 Antibody (3F8) Details:
Clone:3F8
Isotype:IgG3 Kappa
Immunogen:RFC1 (AAH51786, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Epitope:MDIRKFFGVIPSGKKLVSETVKKNEKTKSD EETLKAKKGIKEIKVNSSRKEDDFKQKQPS KKKRIIYDSDSESEETLQVKNAKKPPEKLP VSSKPGKISRQDPVTYISET
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: RFC1
Entrez5981 (Human)
OMIM102579, (Human)
Swiss ProtAAH51786 (Human)
 
Background:

The protein encoded by this gene is the large subunit of replication factor C, which is a five subunit DNA polymerase accessory protein. Replication factor C is a DNA-dependent ATPase that is required for eukaryotic DNA replication and repair. The protein acts as an activator of DNA polymerases, binds to the 3' end of primers, and promotes coordinated synthesis of both strands. It also may have a role in telomere stability.

Jump to: Images, Ask a Question

Working with RFC1

RFC1 Antibody (3F8) Images (1)
Detection limit for recombinant GST tagged RFC1 is approximately 0.3ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about RFC1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC1 Partial Recombinant ProteinH00005981-Q01HuELISA, WB(1)

Primary Antibodies (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC1 AntibodyNB600-961HuIP, WB(1)

RFC1 AntibodyNB100-230HuIP, WB(1)

RFC1 Antibody (3F8)H00005981-M01AHuELISA, WB

RFC1 AntibodyH00005981-A01HuELISA, WB

RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
RFC1 RNAiH00005981-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

RFC1 in Context


Research Areas related to RFC1 (2):
Novus Explorer for RFC1 gene

Try our bioinformatic tool that shows the relationships between RFC1 and other genes, diseases, pathways and post-translational modifications.