Prostatic Acid Phosphatase Antibody (H00000055-B01)
Prostatic Acid Phosphatase Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ACP-3 antibody, anti-PAP antibody, anti-ACP3 antibody, |
|
|
Prostatic Acid Phosphatase Antibody Summary: | | Gene: | ACPP |
|---|
| Purity: | Whole antisera |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACPP - acid phosphatase, prostate, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Prostatic Acid Phosphatase Products Prostatic Acid Phosphatase Antibody Details: | Immunogen: | ACPP (NP_001090, 1 a.a. ~ 386 a.a) full-length human protein. |
|---|
| Epitope: | MRAAPLLLARAASLSLGFLFLLFFWLDRSV LAKELKFVTLVFRHGDRSPIDTFPTDPIKE SSWPQGFGQLTQLGMEQHYELGEYIRKRYR KFLNESYKHEQVYIRSTDVDRTLMSAMTNL AALFPPEGVSIWNPILLWQPIPVHTVPLSE DQLLYLPFRNCPRFQELESETLKSEEFQKR LHPYKDFIATLGKLSGLHGQDLFGIWSKVY DPLYCESVHNFTLPSWATEDTMTKLRELSE LSLLSLYGIHKQKEK |
|---|
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500,
Immunohistochemistry-Paraffin |
|---|
| Unit Size: | 0.05 ml |
|---|
| Concentration: | This product is unpurified. Concentration is not relevant. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | This is unpurified antiserum so it is not possible to supply the specific antibody concentration. |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes an enzyme which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and secreted by the epithelial cells of the prostrate gland.
|
Images (2) Reviews (0) Related Products (21) Exploring Prostatic Acid Phosphatase
|
Jump to: Images, Ask a Question
|
Working with Prostatic Acid Phosphatase
Prostatic Acid Phosphatase Antibody Images (2) Western Blot analysis of ACPP expression in transfected 293T cell line by ACPP MaxPab polyclonal antibody (B01).
Lane 1: ACPP transfected lysate(44.60 KDa).
Lane 2: Non-transfected lysate.
|  Immunoperoxidase of purified MaxPab antibody to ACPP ( Cat# H00000055-B01 ) on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml] |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Prostatic Acid Phosphatase? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (16)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Prostatic Acid Phosphatase Antibody (EPR4067) | NBP1-95472 | Hu, Mu | ICC, IHC-P, IP, WB | (3) | | | | | Prostatic Acid Phosphatase Antibody (EPR4066) | NBP1-95306 | Hu | ICC, IHC-P, IP, WB | (3) | | | | | Prostatic Acid Phosphatase Antibody | NBP1-90263 | Hu | IF, IHC-P, WB | (1) | | | | | Prostatic Acid Phosphatase Antibody | NBP1-51946 | Bv, Ca, Hu, Mu, Rt | PEP-ELISA, WB | | | | | | Prostatic Acid Phosphatase Antibody | NBP1-58296 | Hu, Mu, Rt | WB | (1) | | | | | ... and 11 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Prostatic Acid Phosphatase in Context
Research Areas related to Prostatic Acid Phosphatase (1): |
|
Novus Explorer for Prostatic Acid Phosphatase gene
|
|
