Prostaglandin D2 Receptor Antibody (H00005729-B01P)
Prostaglandin D2 Receptor Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-AS1 antibody, anti-MGC49004 antibody, anti-DP antibody, anti-ASRT1 antibody, |
|
|
Prostaglandin D2 Receptor Antibody Summary: | | Gene: | PTGDR |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PTGDR - prostaglandin D2 receptor (DP), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Prostaglandin D2 Receptor Products Prostaglandin D2 Receptor Antibody Details: | Immunogen: | PTGDR (AAH40968, 1 a.a. ~ 360 a.a) full-length human protein. |
|---|
| Epitope: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTG LLGNLLALGLLARSGLGWCSRRPLRPLPSV FYMLVCGLTVTDLLGKCLLSPVVLAAYAQN RSLRVLAPALDNSLCQAFAFFMSFFGLSST LQLLAMALECWLSLGHPFFYRRHITLRLGA LVAPVVSAFSLAFCALPFMGFGKFVQYCPG TWCFIQMVHEEGSLSVLGYSVLYSSLMALL VLATVLCNLGAMRNLYAMHRRLQRHPRSCT RDCAEPRADGREASP |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful in FACS analysis. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA,
Flow Cytometry |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a G-protein-coupled receptor. It has been shown to function as a prostanoid DP receptor. The activity of this receptor is mainly mediated by G-S proteins that stimulate adenylate cyclase resulting in an elevation of intracellular cAMP and Ca2+. Knockout studies in mice suggest that the ligand of this receptor, prostaglandin D2 (PGD2), functions as a mast cell-derived mediator to trigger asthmatic responses. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (9) Exploring Prostaglandin D2 Receptor
|
Jump to: Images, Ask a Question
|
Working with Prostaglandin D2 Receptor
Prostaglandin D2 Receptor Antibody Images (2) Western Blot analysis of PTGDR expression in transfected 293T cell line by PTGDR MaxPab polyclonal antibody.
Lane 1: PTGDR transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
|  FACS analysis of negative control 293 cells (black) and PTGDR expressing 293 cells (green) using PTGDR purified MaxPab mouse polyclonal antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Prostaglandin D2 Receptor? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (4)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Prostaglandin D2 Receptor in Context
Research Areas related to Prostaglandin D2 Receptor (1): |
|
Novus Explorer for Prostaglandin D2 Receptor gene
|
|
