PPAR alpha Antibody (H00005465-B01P)

PPAR alpha Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
PPAR alpha Antibody Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Polyclonal
Gene:PPARA
Purity:Protein A purified
Host:Mouse
Specificity:PPARA - peroxisome proliferator-activated receptor alpha,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional PPAR alpha Products
PPAR alpha Antibody Details:
Immunogen:PPARA (NP_001001928.1, 1 a.a. ~ 468 a.a) full-length human protein.
Epitope:MVDTESPLCPLSPLEAGDLESPLSEEFLQE MGNIQEISQSIGEDSSGSFGFTEYQYLGSC PGSDGSVITDTLSPASSPSSVTYPVVPGSV DESPSGALNIECRICGDKASGYHYGVHACE GCKGFFRRTIRLKLVYDKCDRSCKIQKKNR NKCQYCRFHKCLSVGMSHNAIRFGRMPRSE KAKLKAEILTCEHDIEDSETADLKSLAKRI YEAYLKNFNMNKVKARVILSGKASNNPPFV IHDMETLCMAEKTLV
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500,
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: PPARA
Entrez5465 (Human)
Swiss ProtNP_001001928.1 (Human)
 
Background:

Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with PPAR alpha

PPAR alpha Antibody Images (2)
Western Blot analysis of PPARA expression in transfected 293T cell line by PPARA MaxPab polyclonal antibody.

Lane 1: PPARA transfected lysate(51.48 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence of purified MaxPab antibody to PPARA on HepG2 cell. [antibody concentration 20 ug/ml]
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about PPAR alpha? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PPAR alpha LysateH00005465-T01HuWB(2)

PPAR alpha LysateNBL1-14631WB(1)

PPAR alpha LysateH00005465-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PPAR alpha Recombinant ProteinH00005465-P01HuELISA, WB(1)(1)

Primary Antibodies (14)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PPAR alpha AntibodyNB600-636Bv, Ca, Ha, Mu, RtELISA, IHC-P, WB(3)

PPAR alpha AntibodyNBP1-61646Hu, Mu, RtELISA, IF, WB(2)

PPAR alpha AntibodyPAB11321Bv, Ca, Ha, Hu, Mk, Mu, Po, RtELISA, WB

PPAR alpha Antibody (3B6/PPAR)NB300-537Hu, Mu, RtGS, IP, WB(3)

PPAR alpha AntibodyH00005465-B01HuELISA, IF, WB(2)

... and 9 more. See All »
RNAi (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PPAR alpha RNAiH00005465-R02Hu(1)(4)

PPAR alpha RNAiH00005465-R01Hu(1)(4)

PPAR alpha RNAiH00005465-R05Hu(1)(4)

PPAR alpha RNAiH00005465-R04Hu(1)(4)

PPAR alpha RNAiH00005465-R03Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

PPAR alpha in Context


Research Areas related to PPAR alpha (3):
Novus Explorer for PPAR alpha gene

Try our bioinformatic tool that shows the relationships between PPARA and other genes, diseases, pathways and post-translational modifications.