PLTP Antibody (H00005360-D01P)
PLTP Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-HDLCQ9 antibody, |
|
|
PLTP Antibody Summary: | | Gene: | PLTP |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | PLTP - phospholipid transfer protein, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PLTP Products PLTP Antibody Details: | Immunogen: | PLTP (AAH19898.1, 1 a.a. ~ 493 a.a) full-length human protein. |
|---|
| Epitope: | MALFGALFLALLAGAHAVFPGCKIRVTSKA LELVKQEGLRFLEQELETITIPDLRGKEGH FYYNISEVKVTELQLTSSELDFQPQQELML QITNASLGLRFRRQLLYWFFYDGGYINASA EGVSIRTGLELSRDPAGRMKVSNVSCQASV SRMHAAFGGTFKKVYDFLSTFITSGMRFLL NQQICPVLYHAGTVLLNSLLDTVPVRSSVD ELVGIDYSLMKDPVASTSNLDMDFRGAFFP LTERNWSLPNRAVEP |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (13) Exploring PLTP
|
Jump to: Images, Ask a Question
|
Working with PLTP
PLTP Antibody Images (2) Western Blot analysis of PLTP expression in transfected 293T cell line by PLTP MaxPab rabbit polyclonal antibody.
Lane 1: PLTP transfected lysate(54.70 KDa).
Lane 2: Non-transfected lysate.
|  PLTP MaxPab rabbit polyclonal antibody. Western Blot analysis of PLTP expression in mouse liver. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about PLTP? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| PLTP Antibody | NB400-106 | Hu, Mu | IHC, IHC-P, WB | (1) | (4) | | | | PLTP Antibody (2F3-G4) | H00005360-M01 | Hu | ELISA, IHC-P, WB | (2) | (1) | | | | PLTP Antibody | NBP1-40173 | Hu, Mu | IHC-P, WB | (1) | | | | | PLTP Antibody | PAB8933 | Hu, Mu | IHC-P, WB | | | | | | PLTP Antibody | H00005360-B01 | Hu | ELISA, WB | (1) | | | | | ... and 3 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
