PLTP Antibody (H00005360-M01)
PLTP Antibody (2F3-G4)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
|
|
PLTP Antibody (2F3-G4) Summary: | | Gene: | PLTP |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PLTP - phospholipid transfer protein |
|---|
| Publications: | Antibody has been mentioned in at least 1 Publication. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PLTP Products PLTP Antibody (2F3-G4) Details: | Clone: | 2F3-G4 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | PLTP (AAH05045, 1 a.a. ~ 422 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | FPGCKIRVTSKALELVKQEGLRFLEQELET ITIPDLRGKEGHFYYNISEVKVTELQLTSS ELDFQPQQELMLQITNASLGLRFRRQLLYW FLKVYDFLSTFITSGMRFLLNQQICPVLYH AGTVLLNSLLDTVPVRSSVDELVGIDYSLM KDPVASTSNLDMDFRGAFFPLTERNWSLPN RAVEPQLQEEERMVYVAFSEFFFDSAMESY FRAGALQLLLVGDKVPHDLDMLLRATYFGS IVLLSPAVIDSPLKL |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|---|
| Dilutions: | ELISA,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene.
|
Images (2) Reviews (0) Related Products (13) Exploring PLTP Working with PLTP
|
Jump to: Publications, Images, Ask a Question
|
Working with PLTP
PLTP Antibody (2F3-G4) Images (2) Immunoperoxidase of monoclonal antibody to PLTP ( Cat # H00005360-M01 ) on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 5ug/ml] |  PLTP monoclonal antibody (M01), clone 2F3-G4 Western Blot analysis of PLTP expression in Hela NE ( Cat # L013V3 ). |
|
|
|
Publications (1)
|
|
|
Ask a Scientist
Can't find an answer to your question about PLTP? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
