PKC iota Antibody (H00005584-M01)
PKC iota Antibody (1G11)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-DXS1179E antibody, anti-PKCI antibody, anti-nPKC-iota antibody, anti-MGC26534 antibody |
|
|
PKC iota Antibody (1G11) Summary: | | Gene: | PRKCI |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PRKCI - protein kinase C, iota |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PKC iota Products PKC iota Antibody (1G11) Details: | Clone: | 1G11 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | PRKCI (AAH22016, 1 a.a. ~ 588 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MSHTVAGGGSGDHSHQVRVKAYYRGDIMIT HFEPSISFEGLCNEVRDMCSFDNEQLFTMK WIDEEGDPCTVSSQLELEEAFRLYELNKDS ELLIHVFPCVPERPGMPCPGEDKSIYRRGA RRWRKLYCANGHTFQAKRFNRRAHCAICTD RIWGLGRQGYKCINCKLLVHKKCHKLVTIE CGRHSLPQEPVMPMDQSSMHSDHAQTVIPY NPSSHESLDQVGEEKEAMNTRESGKASSSL GLQDFDLLRVIGRGS |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500,
RNAi Validation |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. There is a single exon pseudogene mapped on chromosome X.
|
Images (3) Reviews (0) Related Products (15) Exploring PKC iota
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (7)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
