PI 3 Kinase catalytic subunit gamma Antibody (H00005294-M02)
PI 3 Kinase catalytic subunit gamma Antibody (2G3)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-1-phosphatidylinositol 3-kinase antibody, anti-PtdIns-3-kinase antibody, anti-PIK3 antibody, anti-PI3K gamma antibody, anti-PI3K antibody, anti-PI3CG antibody, anti-PI3 kinase antibody, anti-Phosphoinositide-3-kinase catalytic gamma polypeptide antibody, anti-Phosphoinositide-3-k antibody, anti-p110 gamma antibody, |
|
|
PI 3 Kinase catalytic subunit gamma Antibody (2G3) Summary: | | Gene: | PIK3CG |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PI 3 Kinase catalytic subunit gamma Products PI 3 Kinase catalytic subunit gamma Antibody (2G3) Details: | Clone: | 2G3 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | PIK3CG (AAH35683, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | MELENYKQPVVLREDNCRRRRRMKPRSAAA SLSSMELIPIEFVLPTSQRKCKSPETALLH VAGHGNVEQMKAQVWLRALETSVAADFYHR LGPHHFLLLY |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a protein that belongs to the pi3/pi4-kinase family of proteins. The gene product is an enzyme that phosphorylates phosphoinositides on the 3-hydroxyl group of the inositol ring. It is an important modulator of extracellular signals, including those elicited by E-cadherin-mediated cell-cell adhesion, which plays an important role in maintenance of the structural and functional integrity of epithelia. In addition to its role in promoting assembly of adherens junctions, the protein is thought to play a pivotal role in the regulation of cytotoxicity in NK cells. The gene is located in a commonly deleted segment of chromosome 7 previously identified in myeloid leukemias.
|
Images (1) Reviews (0) Related Products (12) Exploring PI 3 Kinase catalytic subunit gamma
|
Jump to: Images, Ask a Question
|
Working with PI 3 Kinase catalytic subunit gamma
PI 3 Kinase catalytic subunit gamma Antibody (2G3) Images (1) Detection limit for recombinant GST tagged PIK3CG is approximately 10ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about PI 3 Kinase catalytic subunit gamma? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (1)Primary Antibodies (3)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| PI 3 Kinase catalytic subunit gamma in Context
Research Areas related to PI 3 Kinase catalytic subunit gamma (2): |
|
Novus Explorer for PI 3 Kinase catalytic subunit gamma gene
|
|
