Recombinant Mouse PDGFA Protein Summary
| Description |
Pdgfa/Pdgfa (Mouse) Recombinant Protein
Source: E. coli
Amino Acid Sequence: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT |
Preparation Method |
Escherichia coli expression system |
| Details of Functionality |
The activity is determined by the dose-dependent proliferation of Balb/c 3T3 cells. The expected ED50 for this effect is 3.4-5 ng/mL. |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
PDGFA |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This product is useful for SDS-PAGE,Func. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
No additive Reconstitute with sterilized water. |
| Preservative |
No Preservative |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Mouse PDGFA Protein
Background
Platelet-Derived Growth Factor (PDGF) is the major serum mitogen for cells of mesenchymal origin in humans. The biologically active protein is a dimer composed of two related polypeptides designated A and B. The PDGF protein has been implicated both directly as well as indirectly in several pathological states including neoplasia, arthritis, arteriosclerosis and bone marrow sclerosis. This antibody is specific for B form and reacts with PDGF(AB) and PDGF(BB) protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: Flow, IHC, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Publications for PDGFA Recombinant Protein (P4802) (0)
There are no publications for PDGFA Recombinant Protein (P4802).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PDGFA Recombinant Protein (P4802) (0)
There are no reviews for PDGFA Recombinant Protein (P4802).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PDGFA Recombinant Protein (P4802) (0)