PCBP2 Antibody (H00005094-M07)

PCBP2 Antibody (5F12)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
PCBP2 Antibody (5F12) Summary:
Species:Hu
Applications:ELISA, IF, IHC-P, RNAi, WB
Clonality:Monoclonal
Gene:PCBP2
Purity:IgG purified
Host:Mouse
Specificity:PCBP2 - poly(rC) binding protein 2
Publications:Antibody has been mentioned in at least 4 Publications.
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional PCBP2 Products
PCBP2 Antibody (5F12) Details:
Clone:5F12
Isotype:IgG2a Kappa
Immunogen:PCBP2 (AAH01155, 1 a.a. ~ 363 a.a) full length recombinant protein with GST tag.
Epitope:MDTGVIEGGLNVTLTIRLLMHGKEVGSIIG KKGESVKKMREESGARINISEGNCPERIIT LAGPTNAIFKAFAMIIDKLEEDISSSMTNS TAASRPPVTLRLVVPASQCGSLIGKGGCKI KEIRESTGAQVQVAGDMLPNSTERAITIAG IPQSIIECVKQICVVMLESPPKGVTIPYRP KPSSSPVIFAGGQDRYSTGSDSASFPHTTP SMCLNPDLEGPPLEAYTIQGQYAIPQPDLT KLHQLAMQQSHFPMT
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), RNAi validation and ELISA.
Dilutions:ELISA, immunofluorescence, Immunohistochemistry-Paraffin, RNAi Validation, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: PCBP2
Entrez5094 (Human)
OMIM601210, (Human)
Swiss ProtAAH01155 (Human)
 
Background:

The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of only three have been characterized to date.

Jump to: Publications, Images, Reviews, Ask a Question

Working with PCBP2

PCBP2 Antibody (5F12) Images (6)
Western blot analysis of PCBP2 over-expressed 293 cell line, cotransfected with PCBP2 Validated Chimera RNAi or non-transfected control. Blot probed with H00005094-M07. GAPDH (36.1 kDa) used as loading control.Western Blot analysis of PCBP2 expression in transfected 293T cell line by PCBP2 monoclonal antibody (M07), clone 5F12.

Lane 1: PCBP2 transfected lysate(38.7 KDa).
Lane 2: Non-transfected lysate.
Immunoperoxidase of monoclonal antibody to PCBP2 ( Cat # H00005094-M07 ) on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]Immunofluorescence of monoclonal antibody to PCBP2 (H00005094-M07) on HeLa cell . [antibody concentration 10 ug/ml]
PCBP2 monoclonal antibody (M07), clone 5F12 Western Blot analysis of PCBP2 expression in K-562 ( Cat # L009V1 ).Detection limit for recombinant GST tagged PCBP2 is approximately 0.1ng/ml as a capture antibody.
Reviews (1)  Have you used this product? Review this product to earn Novus Rewards.
Full StarFull StarFull StarEmpty StarEmpty Star

Reviewed by:
Anonymous 2/24/2010

Application: Western Blot
Sample Tested: human liver cells
Sample Loaded: 15 ug
Results: not very sensitive
Blocking Buffer: 5% BSA in PBST
Concentration: 5
Blocking Time: 1 hour
Blocking Temperature: room
Incubation Time: 10 hrs
Incubation Temperature: 4 Celsius
Incubation Dilution Buffer: 5% BSA in PBST
Description: ECL anti-mouse IgG
Method: pierce dura chemiluminescent kit
Exposure Time: 3 min
Positive Control: -
Negative Control: sc
Did you observe bands?: True
Specific Bands: 40 kDa
Non-specific Bands: - kDa

 

Publications (4)

PCBP2 Antibody (5F12) Product Specific:

  1. Lawrence P, Rieder E. Identification of RNA helicase A as a new host factor in the replication cycle of foot-and-mouth disease virus. J Virol. 2009 Aug 26. [PMID: 19710149]
  2. Fujimura K, Kano F, Murata M. Identification of PCBP2, a facilitator of IRES-mediated translation, as a novel constituent of stress granules processing bodies. RNA. 2008 Mar;14(3):425-31. - (pubmed 18174314)

more...

Ask a Scientist

Can't find an answer to your question about PCBP2? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PCBP2 Antibody PairH00005094-PW1HuIP, WB

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PCBP2 LysateNBL1-14143WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PCBP2 Recombinant ProteinH00005094-P01HuELISA, WB(1)

PCBP2 Partial Recombinant ProteinH00005094-Q01HuELISA, WB(1)

Primary Antibodies (11)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PCBP2 AntibodyNBP1-83241HuIF, IHC-P, WB(3)

PCBP2 AntibodyNBP1-57323Ca, Hu, Mu, RtIHC-P, WB(1)

PCBP2 AntibodyNBP1-31154HuDB, WB(2)

PCBP2 Antibody (5F12)NBP1-69823HuELISA, IF, IHC-P, RNAi, WB

PCBP2 Antibody (1B6)H00005094-M02HuELISA, WB(2)

... and 6 more. See All »
RNAi (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
PCBP2 RNAiH00005094-R01VHu(2)(4)

PCBP2 RNAiH00005094-R02Hu(1)(4)

PCBP2 RNAiH00005094-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

PCBP2 in Context


Novus Explorer for PCBP2 gene

Try our bioinformatic tool that shows the relationships between PCBP2 and other genes, diseases, pathways and post-translational modifications.