PARP Antibody (H00000142-M01)
PARP Antibody (3G4)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ADPRT antibody, anti-PPOL antibody, anti-PARP-1 antibody, anti-PARP antibody, anti-pADPRT-1 antibody, anti-ADPRT1 antibody, |
|
|
PARP Antibody (3G4) Summary: | | Gene: | PARP1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | PARP1 - poly (ADP-ribose) polymerase family, member 1 |
|---|
| Publications: | Antibody has been mentioned in at least 1 Publication. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional PARP Products PARP Antibody (3G4) Details: | Clone: | 3G4 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | MAESSDKLYRVEYAKSGRASCKKCSESIPK DSLRMAIMVQSPMFDGKVPHWYHFSCFWKV GHSIRHPDVEVDGFSELRWDDQQKVKKTAE AGGVTGKGQD |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes.
|
Images (3) Reviews (0) Related Products (27) Exploring PARP Working with PARP
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (23)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| PARP Antibody (C-2-10) | NB100-111 | Bv, Ch(-), Ha, Hu, Mk, Mu, Rt | ELISA, ICC, WB | (1) | (3) | | | | PARP Antibody (E102) | NB110-57323 | Hu, Mu(-), Rt | FACS, ICC, IHC-P, WB | (4) | (1) | | | | PARP Antibody (A6.4.12) | NB100-64828 | Dr, Hu, Mu, Rt, Xp | ELISA, IF, IHC-Fr, IHC-P, IP, WB | (1) | (3) | | | | PARP Antibody | NB100-61616 | Hu | IHC-P, WB | (3) | | | | | PARP Antibody | NSB698 | Bv, Hu | ICC, WB | (2) | (2) | | | | ... and 18 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of monoclonal antibody to PARP1 (H00000142-M01) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00000142-M01-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to PARP1 (H00000142-M01) on HeLa cell . [antibody concentration 10 ug/ml]")
