Niemann-Pick C1 Antibody (H00004864-M02)
Niemann-Pick C1 Antibody (4H2)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Niemann Pick C1 antibody, type C1 antibody, anti-NPC1 antibody, anti-NPC antibody, anti-Niemann Pick disease, anti-Niemann Pick C1 protein precursor antibody, |
|
|
Niemann-Pick C1 Antibody (4H2) Summary: | | Gene: | NPC1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | NPC1 - Niemann-Pick disease, type C1 |
|---|
| Publications: | Antibody has been mentioned in at least 1 Publication. |
|---|
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Niemann-Pick C1 Products Niemann-Pick C1 Antibody (4H2) Details: | Clone: | 4H2 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | NPC1 (AAH63302, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. |
|---|
| Localization: | Late endosome and Lysosome membrane; Single-pass membrane protein. |
|---|
| Epitope: | GFANAMYNACRDVEAPSSNDKALGLLCGKD ADACNATNWIEY
MFNKDNGQAPFTITPV FSDFPVHGMEPMNNATKGCDESVDEV
TA PCSCQDCSIVCGPK |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Phosphate buffered saline, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene was identified as the gene that when mutated, results in Niemann-Pick C disease. The encoded protein is a putative integral membrane protein that contains motifs consistent with a role in intracellular transport of cholesterol to post-lysosomal destinations.
|
Images (1) Reviews (0) Related Products (14) Exploring Niemann-Pick C1 Working with Niemann-Pick C1
|
Jump to: Publications, Images, Ask a Question
|
Working with Niemann-Pick C1
Niemann-Pick C1 Antibody (4H2) Images (1) Detection limit for recombinant GST tagged NPC1 is approximately 0.03ng/ml as a capture antibody. |
|
|
|
Publications (1)
|
|
|
Ask a Scientist
Can't find an answer to your question about Niemann-Pick C1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsPeptides and ProteinsPrimary Antibodies (11)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Niemann-Pick C1 Antibody | NB400-148 | ChHa, Hu, Mu | IF, IHC-P, IP, WB | (2) | (11) | | | | Niemann-Pick C1 Antibody (EPR5209) | NBP1-95817 | Hu, Mu, Rt | ICC, IHC-P, WB | (2) | | | | | Niemann-Pick C1 Antibody | PAB12093 | Ha, Hu, Mu | IF, IHC-P, IP, WB | | | | | | Niemann-Pick C1 Antibody | PAB16750 | Hu | ELISA, IHC-P, WB | | | | | | Niemann-Pick C1 Antibody | PAB18649 | Mu | ELISA | | | | | | ... and 6 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Niemann-Pick C1 in Context
Research Areas related to Niemann-Pick C1 (3): |
|
Novus Explorer for Niemann-Pick C1 gene
|
|
