Neuropeptide Y Antibody (H00004852-M04)

Neuropeptide Y Antibody (3F8)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
Neuropeptide Y Antibody (3F8) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:NPY
Purity:IgG purified
Host:Mouse
Specificity:NPY - neuropeptide Y (3F8)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Neuropeptide Y Products
Neuropeptide Y Antibody (3F8) Details:
Clone:3F8
Isotype:IgG1 Kappa
Immunogen:NPY (AAH29497, 29 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:YPSKPDNPGEDAPAEDMARYYSALRHYINL ITRQRYGKRSSPETLISDLLMRESTENVPR TRLEDPAMW*
Species Reactivity:

Human.

Applications:
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: NPY
Entrez4852 (Human)
Swiss ProtAAH29497 (Human)
 
Jump to: Images, Ask a Question

Working with Neuropeptide Y

Neuropeptide Y Antibody (3F8) Images (1)
Detection limit for recombinant GST tagged NPY is approximately 0.03ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Neuropeptide Y? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Neuropeptide Y LysateNBL1-13759WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Neuropeptide Y Recombinant ProteinH00004852-P02HuELISA, WB(1)

Neuropeptide Y Partial Recombinant ProteinH00004852-Q01HuELISA, WB(1)

Neuropeptide Y Recombinant ProteinH00004852-P01HuELISA, WB(1)

Neuropeptide Y ProteinBP908CP

Primary Antibodies (13)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Neuropeptide Y AntibodyNB600-1094Bv, Fe, Hu, Mk, Mu, Po, Rb, RtIHC-Fr, RIA(1)(4)

Neuropeptide Y AntibodyNB100-1624Hu, MuIHC-Fr, IHC-P, WB(2)(1)

Neuropeptide Y AntibodyNBP1-46535Hu, Mu, Rb, Rt, XpIHC-Fr, IHC-P, WB

Neuropeptide Y AntibodyNBP1-78352Fe, Fi, Hu, RtICC, IHC-P(1)

Neuropeptide Y AntibodyNB100-65835HuELISA, IHC-P, WB(1)

... and 8 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Neuropeptide Y RNAiH00004852-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Neuropeptide Y in Context


Research Areas related to Neuropeptide Y (3):
Novus Explorer for Neuropeptide Y gene

Try our bioinformatic tool that shows the relationships between NPY and other genes, diseases, pathways and post-translational modifications.