NR0B1 Antibody (H00000190-M03)
NR0B1 Antibody (1F10)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-AHC antibody, anti-NROB1 antibody, anti-HHG antibody, anti-GTD antibody, anti-DSS antibody, anti-DAX-1 antibody, anti-DAX1 antibody, anti-AHX antibody, anti-AHCH antibody, |
|
|
NR0B1 Antibody (1F10) Summary: | | Gene: | NR0B1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional NR0B1 Products NR0B1 Antibody (1F10) Details: | Clone: | 1F10 |
|---|
| Isotype: | IgG3 Kappa |
|---|
| Immunogen: | NR0B1 (NP_000466, 361 a.a. ~ 471 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | IKCFLSKCWSLNISTKEYAYLKGTVLFNPD VPGLQCVKYIQGLQWGTQQILSEHTRMTHQ GPHDRFIELNSTLFLLRFINANVIAELFFR PIIGTVSMDDMMLEMLCTKI* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.
|
Images (3) Reviews (0) Related Products (22) Exploring NR0B1
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (12)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunofluorescence of monoclonal antibody to NR0B1 (H00000190-M03) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00000190-M03-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to NR0B1 (H00000190-M03) on HeLa cell . [antibody concentration 10 ug/ml]")
