| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NPY5R |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82533 | Applications | Species |
|---|---|---|
| Larsson K, Hofstrom C, Lindskog C et al. Novel antigen design for the generation of antibodies to G-protein-coupled receptors. J Immunol Methods 2011-07-01 [PMID: 21605562] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NPY5R Antibody (NBP1-82533)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPY5R |
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Carbonic Anhydrase III/CA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_III_AF2185_Western_Blot_20454.jpg)
![Simple Western DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Simple_Western_20720.jpg)
![Immunohistochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunohistochemistry_17209.jpg)
![Immunocytochemistry DPPIV/CD26 Antibody [Unconjugated]](https://images.novusbio.com/images2/DPPIV_AF1180_Immunocytochemistry__Immunofluorescence_17210.jpg)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020121349.png)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020122737.png)
![N/A ERK1 [p Thr202, p Tyr204] [Biotin]](https://images.novusbio.com/images2/dyc1825-2_phospho-erk1-duoset-ic-economy-pack-15-plate-17122020122919.png)
